Align Galactofuranose transporter permease protein YtfT (characterized)
to candidate 3609043 Dshi_2432 Monosaccharide-transporting ATPase (RefSeq)
Query= SwissProt::P39328 (341 letters) >FitnessBrowser__Dino:3609043 Length = 327 Score = 133 bits (334), Expect = 7e-36 Identities = 101/285 (35%), Positives = 146/285 (51%), Gaps = 17/285 (5%) Query: 25 LVALLLVLLVDSLVAPHFWQVVLQDGRLFGSPIDILNRAAPVALLAIGMTLVIATGGIDL 84 L+A +L+LL +L+A F + + N +P+ LLAIG +VI T IDL Sbjct: 13 LIAAILLLL--ALIASRFPAFIAPSNLAH-----VFNDTSPLILLAIGQMIVILTRCIDL 65 Query: 85 SVGAVMAIAGATTAAMTVAGFSLPIV--LLSALGTGILAGLWNGILVAILKIQPFVATLI 142 SV A +A+ G + + VA LPIV L A+G G L G++NG+LV L+I P V TL Sbjct: 66 SVAANLALTGMVVSMVNVAAPGLPIVVILAIAIGLGTLLGMFNGLLVWKLQIPPIVVTLG 125 Query: 143 LMVAGRGVAQLITAGQIVTFN--SPDLSWFGSGSLLFLPTPVIIAVLTLILFWLLTRKTA 200 M RG+ LI+ G+ V + SP F LL LP IA+L +ILF ++ +T Sbjct: 126 TMTIFRGIIFLISDGKWVNSHEMSPAFKAFPRAELLGLPVLSWIAILAVILFTIVMTRTT 185 Query: 201 LGMFIEAVGINIRAAKNAGVNTRIIVMLTYVLSGLCAAIAGIIVAADIRGADANNAGLWL 260 LG A G N AA AG++ + +SG A + G + + + + AG Sbjct: 186 LGRAFYAAGGNPHAATYAGIDVGKTQFWAFTISGALAGLTGYLWVSRFAVSYVDIAG-GF 244 Query: 261 ELDAILAVVIGGGSLMGGRFNLLLSVVGALIIQGMNTGILLSGFP 305 ELD + A VIGG S+MGG + VG ++ + GI+ + P Sbjct: 245 ELDVVAACVIGGVSIMGG-----VGTVGGALLGALFLGIIKNALP 284 Lambda K H 0.327 0.142 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 319 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 341 Length of database: 327 Length adjustment: 28 Effective length of query: 313 Effective length of database: 299 Effective search space: 93587 Effective search space used: 93587 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory