Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate 3607124 Dshi_0546 ABC transporter related (RefSeq)
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >FitnessBrowser__Dino:3607124 Length = 338 Score = 149 bits (376), Expect = 8e-41 Identities = 94/249 (37%), Positives = 144/249 (57%), Gaps = 22/249 (8%) Query: 16 LEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQILLD 75 ++I ++K YG + L ++L ++ G V +G SG GK+TLLR + LE G+I + Sbjct: 4 IKIDKINKFYGTTQALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSGRIEIG 63 Query: 76 GESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLHKD 135 G + V +++ +A M FQ + L+PH+T +N+ G+ KV D Sbjct: 64 GRDV-------TTVEPADRDLA-------MVFQSYALYPHMTVRENMEFGM-KVNGFEPD 108 Query: 136 ---EAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALD 192 E + A + L+ L+R+ PGQLSGGQ+QRVAI RAI NPS+ LFDE S LD Sbjct: 109 LRKERIAEAARVLQLEDYLDRK---PGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLD 165 Query: 193 PELVGEVLSVIKGLAED-GMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERP 251 +L ++ ++GL + G TM+ VTH+ A ++DKIV +N+GRIE+ G P +L+ +P Sbjct: 166 AKLRVQMRVELEGLHKQLGATMIYVTHDQVEAMTMADKIVVLNRGRIEQVGSPMDLYHKP 225 Query: 252 QSPRLAEFL 260 S +AEF+ Sbjct: 226 NSRFVAEFI 234 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 212 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 338 Length adjustment: 27 Effective length of query: 238 Effective length of database: 311 Effective search space: 74018 Effective search space used: 74018 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory