Align ABC transporter for D-glucosamine, ATPase component (characterized)
to candidate 3608728 Dshi_2120 ABC transporter related (RefSeq)
Query= reanno::pseudo3_N2E3:AO353_21725 (265 letters) >FitnessBrowser__Dino:3608728 Length = 376 Score = 166 bits (421), Expect = 5e-46 Identities = 98/259 (37%), Positives = 151/259 (58%), Gaps = 16/259 (6%) Query: 3 QAQVSTQNASQALLEIRDLHKQYGPLEVLKGVDLTMQRGNVVTLIGSSGSGKTTLLRCVN 62 +A +S+ +++ ++ K++G +K D + RG + ++GSSG GKTT LR + Sbjct: 2 KANAQMDQSSEPIVKFDNVVKRFGSFTAVKKADFEIGRGEFLAIMGSSGCGKTTTLRMLA 61 Query: 63 MLEEFQGGQILLDGESIGYHEVNGKRVRHSEKVIAQHRAMTGMAFQQFNLFPHLTALQNV 122 LE+ G I LDGE +VNGK + T M +Q LFP LT +NV Sbjct: 62 GLEDPTEGAIYLDGE-----QVNGKATWDRD---------TPMVWQSLALFPFLTVQENV 107 Query: 123 TLGLLKVKKLHKDEAVVLAEKWLERVGLLERRDHYPGQLSGGQQQRVAIARAIAMNPSLM 182 L K++ + K+E A+KWL+++ + E D QLSGGQ+QRVA+ARA+ P ++ Sbjct: 108 EFAL-KMRGIGKEERRQRADKWLDKMQITEFADRNINQLSGGQKQRVALARALVTEPKIL 166 Query: 183 LFDEVTSALDPELVGEVLSVIKGLAED-GMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQ 241 L DE SALD L + SV+ L +D G+T + VTH M AF ++D++V M++G+IE+ Sbjct: 167 LLDEPLSALDAHLKVRMQSVLSNLQKDLGITFVYVTHSMSEAFSMADRVVIMSRGQIEQI 226 Query: 242 GPPKELFERPQSPRLAEFL 260 G P+E++ P + +AEFL Sbjct: 227 GTPEEIYREPHNRFVAEFL 245 Lambda K H 0.319 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 10 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 376 Length adjustment: 27 Effective length of query: 238 Effective length of database: 349 Effective search space: 83062 Effective search space used: 83062 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory