Align ABC transporter for N-Acetyl-D-glucosamine, permease protein 2 (characterized)
to candidate 3607838 Dshi_1246 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= reanno::Smeli:SMc02871 (279 letters) >FitnessBrowser__Dino:3607838 Length = 282 Score = 123 bits (309), Expect = 4e-33 Identities = 67/219 (30%), Positives = 112/219 (51%) Query: 61 YETVLKQGDFIGYFQNSIIVTVVSIALVLLFGAMAAFALSEYRFRGNTLMGLYLALGIMI 120 Y V + Y NS ++T+ ++ + M FAL YRFRGN L+ G + Sbjct: 64 YARVFTDSEMPRYILNSFMITIPTVIGAVALSCMTGFALGIYRFRGNLLIFFMFIAGNFV 123 Query: 121 PIRLGTVAILQGMVATGLVNTLTALILVYTAQGLPLAVFILSEFMRTVSDDLKNAGRIDG 180 P ++ V + V GL NT T L+L + A + F+R + +L A R++G Sbjct: 124 PFQILMVPVRDLTVDMGLYNTKTGLVLFHIAFQTGFCTLFMRNFIRALPYELIEAARVEG 183 Query: 181 LSEYAIFLRLVLPLIRPAMATVAVFTMIPIWNDLWFPLILAPAEATKTVTLGSQIFIGQF 240 ++E+ IF +VLPL++PA+A ++V IWND ++ ++L + VT G F QF Sbjct: 184 VAEWRIFWFVVLPLMKPAIAALSVLIFTFIWNDYFWAVVLTQGPNAQPVTAGITSFNAQF 243 Query: 241 VTNWNAVLSALSLAIFPVLVLYVIFSRQLIRGITAGAVK 279 +N + + +A P ++++ + + I G+T GAVK Sbjct: 244 GIAYNMLSAGSLIAALPPVMMFFLMQKHFIAGLTLGAVK 282 Lambda K H 0.330 0.142 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 230 Number of extensions: 18 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 279 Length of database: 282 Length adjustment: 26 Effective length of query: 253 Effective length of database: 256 Effective search space: 64768 Effective search space used: 64768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory