Align glucose 1-dehydrogenase (PQQ, quinone) (EC 1.1.5.2) (characterized)
to candidate 3608476 Dshi_1872 hypothetical protein (RefSeq)
Query= BRENDA::I7A144 (352 letters) >FitnessBrowser__Dino:3608476 Length = 422 Score = 143 bits (360), Expect = 9e-39 Identities = 97/271 (35%), Positives = 140/271 (51%), Gaps = 41/271 (15%) Query: 16 ARGQGLRVEEVVGGLEVPWALAFLPDGGMLIAER---------PGRIR--LFREGRLSTY 64 A L E V+ GLE PW +AFL DG M E+ G + L +G Y Sbjct: 26 ANTTSLSHEIVLEGLENPWDVAFLEDGTMFFTEKCLGLSVRLPDGSVNKLLGMKGTDDDY 85 Query: 65 AELP--VYHRGESGLLGLALHPRFPEAPYVYAYRT---VAEGGLRNQVVRLRHLGE--RG 117 A ++ G++G+ G+A+ P F E +Y Y T A G N+++R+ +GE Sbjct: 86 ASTAEDLFCEGQAGMQGVAVDPDFAENRQIYVYSTSDLTAPGS--NRLLRMT-VGEDLAS 142 Query: 118 VLDRV-VLDGIPARPH---------GLHSGGRIAFGPDGMLYVTTGEVYERELAQDLASL 167 V DR +++ +P +P G H+GGR+ FGPDG +Y+TTG+ + E Q L Sbjct: 143 VADRTDIVEDVPYKPAATDHPFGGPGAHNGGRVRFGPDGFIYLTTGDTHNGEGPQSPTLL 202 Query: 168 GGKILRLTPEGEPAPGNPFLGRRGARPEVYSLGHRNPQGLAWHPKTGELFSSEHGPSGEQ 227 GK+LR+ +G A GN G P +Y+ GHRN QG+ +HP+TG ++EHGP Sbjct: 203 AGKVLRIDRDGNAAEGN--APPEGFDPRIYTYGHRNTQGITFHPETGAAITAEHGP---- 256 Query: 228 GYGHDEVNLIVPGGNYGW---PRVVGRGNDP 255 + DE+ ++ GGN GW P V GRG P Sbjct: 257 -WHSDEITVLQNGGNAGWDPRPNVGGRGECP 286 Score = 24.6 bits (52), Expect = 0.005 Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Query: 320 VQVGPDGALYVTTSN-RDGRGQVRP 343 V+ GPDG +Y+TT + +G G P Sbjct: 175 VRFGPDGFIYLTTGDTHNGEGPQSP 199 Lambda K H 0.322 0.146 0.460 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 540 Number of extensions: 35 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 3 Number of HSP's successfully gapped: 3 Length of query: 352 Length of database: 422 Length adjustment: 30 Effective length of query: 322 Effective length of database: 392 Effective search space: 126224 Effective search space used: 126224 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory