Align Glucosaminate ammonia-lyase; EC 4.3.1.9; D-glucosaminate dehydratase alpha-subunit; GlcNA-DH alpha subunit; GlcNADH-alpha (uncharacterized)
to candidate 3609268 Dshi_2654 thioredoxin reductase (RefSeq)
Query= curated2:Q93HX6 (320 letters) >FitnessBrowser__Dino:3609268 Length = 332 Score = 330 bits (847), Expect = 2e-95 Identities = 178/315 (56%), Positives = 226/315 (71%), Gaps = 13/315 (4%) Query: 3 EVRHSRVIILGSGPAGYSAAVYAARANLKPLLITGMQAGGQLTTTTEVDNWPGDVHGLTG 62 E RH +V+I+GSGPAGY+AAVYA+RA L P+L+ G+Q GGQLT TT+V+NWPGD + G Sbjct: 4 ETRHLKVLIIGSGPAGYTAAVYASRAMLNPVLVQGIQPGGQLTITTDVENWPGD-SSVMG 62 Query: 63 PALMERMREHAERFETEIVFDHINAVDFAAKPYTLTGDSAT-YTCDALIIATGASARYLG 121 P LM RM EHA+ TEI+ DHIN +D +++P+T GDS T Y +ALI+ATGA A++LG Sbjct: 63 PDLMVRMEEHAKAMGTEIIADHINRLDLSSRPFTAYGDSGTIYKAEALILATGAQAKWLG 122 Query: 122 LPSEEAFMGKGVSACATCDGFFYRNKPVAVVGGGNTAVEEALYLANIASTVTLIHRRETF 181 LPSEE F G GVSACATCDGFFYR K V V+GGGNTAVEEAL+L N AS VTL+HRR++ Sbjct: 123 LPSEEHFKGFGVSACATCDGFFYRGKEVVVIGGGNTAVEEALFLTNFASKVTLVHRRDSL 182 Query: 182 RAEKILIDKLNARVAEGKIILKLNANLDEVLGDN--MGVTGARLKNND-GSFDELKVDGV 238 RAEKIL D+L K+ + + ++EV+G + GV G +K+ D G L G Sbjct: 183 RAEKILQDRL---FKNPKVEVIWDHTVEEVVGTDTPRGVEGVVIKHRDTGETRTLPCAGF 239 Query: 239 FIAIGHTPNTSLFEGQL-TLKDGYLVVQGGRDGNATATSVEGIFAAGDVADHVYRQAITS 297 F+AIGH P + L QL T GY+V ++TATS+ G+FAAGD+ DH YRQA+TS Sbjct: 240 FVAIGHAPASELVIDQLETHMGGYVVTA----PDSTATSIPGVFAAGDLTDHEYRQAVTS 295 Query: 298 AGAGCMAALDTERYL 312 AG GCMAAL+ ER+L Sbjct: 296 AGMGCMAALEAERFL 310 Lambda K H 0.318 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 329 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 332 Length adjustment: 28 Effective length of query: 292 Effective length of database: 304 Effective search space: 88768 Effective search space used: 88768 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory