GapMind for catabolism of small carbon sources

 

Aligments for a candidate for nagF in Dinoroseobacter shibae DFL-12

Align N-Acetyl-D-Glucosamine phosphotransferase system transporter, component of N-acetyl glucosamine-specific PTS permease, GlcNAc IIBC/GlcNAc I-HPr-IIA (characterized)
to candidate 3608669 Dshi_2062 PTSINtr with GAF domain, PtsP (RefSeq)

Query= TCDB::Q9HXN5
         (842 letters)



>lcl|FitnessBrowser__Dino:3608669 Dshi_2062 PTSINtr with GAF domain,
           PtsP (RefSeq)
          Length = 747

 Score =  233 bits (594), Expect = 3e-65
 Identities = 174/547 (31%), Positives = 263/547 (48%), Gaps = 21/547 (3%)

Query: 283 LAGVCASPGLASGPL----ARLGAISLPADDGRHRPEEQHLALDQALQRVRDDVQGSLQQ 338
           + G  A  G+A G +     R+    L +DD    PE + + L  A+ ++R  V   L  
Sbjct: 183 IRGGVAQEGIAKGHVYLHEPRVVVTKLVSDD----PEAELVRLRGAVDQLRVSVDEMLDI 238

Query: 339 ARLGGDENEAAIFSAHLALLEDPGLLDAADMLIDQGVGAAHAWHRAIQAQCEILQALGNL 398
           A  G D  +  I  A+       G +   +  ID G+ A  A  +   A    ++ + + 
Sbjct: 239 APKG-DAEQLQILEAYRMFANSRGWMRRMEESIDSGLSAEAAVEKEQSAARSRMERVPDA 297

Query: 399 LLAERANDLRDLEKRVLRVLLGDTAPL--RVPAGAIVAAREITPSDLAPLVDAGAA--GL 454
            L ER +DL DL  R+LR+L G        +PA  I+ AR I P +L   +D G A  G+
Sbjct: 298 YLRERLHDLDDLSNRLLRLLTGQGGETGAEIPADPILVARNIGPGEL---LDYGRALKGI 354

Query: 455 CMAEGGATSHVAILARSKGLPCLVALGAGLLELEEGRQVVLDAGQGRLELSPDARRLEQV 514
            + EG   SH AI+AR+  +P +V       E   G  V++D  QG + L PD R L   
Sbjct: 355 ILEEGSVGSHAAIVARALAIPLIVHAKRITTEALNGDLVLVDGEQGIVHLRPDDRVLAHF 414

Query: 515 ALQVAQREEQRRRQQADAQREALTRDGRRIEIGANVASPREAAEAFANGADGVGLLRTEF 574
             ++A + + + R  +   + A T  G  I +  N     +     ++GA+GVGL RTE 
Sbjct: 415 TDKIAMQAKAQERYASIRDKPAETLCGSVISLTMNAGLMADLPSLPSSGAEGVGLFRTEL 474

Query: 575 LFLERRAAPDEEEQRNAYQEVLDAMGQRKVIIRTIDVGGDKHLDYLPLPVEENPALGLRG 634
            FL R   P   E    Y  VLDA   ++V+ RT+D+G DK L Y+    E NPALG R 
Sbjct: 475 QFLTRSKVPRRSELAEIYARVLDAADGKRVVFRTLDIGSDKVLPYMKPQDEPNPALGWRA 534

Query: 635 IHLGQARPELLDQQLRALLRVEPLERCRILLPMVSEVDEL-RAIRRRLGELATQLGIER- 692
           I +G  +P ++  QL+AL+R        ++ P +++++E  RA    L E+  +  + R 
Sbjct: 535 IRVGLDKPGVMRMQLQALIRGANGRPLTVMFPFIAQLEEFTRARDALLREIDREAALGRT 594

Query: 693 LP---ELGVMIEVPSAALLADQLAEHADFLSIGTNDLSQYALAMDRCHAGLADRIDALHP 749
           LP   E+G M+E PS A   +   E ADF+SIG NDL Q+  A DR +  +  R D L+ 
Sbjct: 595 LPESVEIGAMLETPSLAFAPNSFFEMADFVSIGGNDLKQFFFAADRENERVRRRYDTLNV 654

Query: 750 ALLRLIAQTCAGAARHGRWVGVCGALASDPLATPVLVGLGVEELSVGPNLVGEIKTRVRQ 809
           + L LI    +     G  +  CG  A  P+       +G+  LS+ P  +G +K  +R+
Sbjct: 655 SFLSLIELIVSRCRDVGTPLSFCGEDAGRPIEALCFAAMGLRSLSMRPASIGPVKHLLRR 714

Query: 810 LDAAECR 816
            D  E R
Sbjct: 715 SDLREAR 721


Lambda     K      H
   0.319    0.136    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1410
Number of extensions: 70
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 842
Length of database: 747
Length adjustment: 41
Effective length of query: 801
Effective length of database: 706
Effective search space:   565506
Effective search space used:   565506
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory