GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mglC in Dinoroseobacter shibae DFL-12

Align glucose transporter, permease component (characterized)
to candidate 3608606 Dshi_1999 inner-membrane translocator (RefSeq)

Query= reanno::Phaeo:GFF3640
         (433 letters)



>lcl|FitnessBrowser__Dino:3608606 Dshi_1999 inner-membrane
           translocator (RefSeq)
          Length = 435

 Score =  632 bits (1631), Expect = 0.0
 Identities = 315/428 (73%), Positives = 363/428 (84%)

Query: 5   TSQPIPEHSKRGLFQQLELDVRLLGMIGAFVILCIGFNILTDGRFLTPRNIFNLTIQTVS 64
           T   +P  +KR   Q LELD RLLGMIGAFV++C+ FN+LTDGRFLT RNIFNL+IQTVS
Sbjct: 7   TESRLPSRAKRSFLQTLELDTRLLGMIGAFVLVCLVFNLLTDGRFLTARNIFNLSIQTVS 66

Query: 65  VAIMATGMVFVIVTRHIDLSVGALLATCSAVMAVVQTDVLPDMFGLGLNHPATWIITVAV 124
           VAIMATGMVF+IVTRHIDL+VGALLATCSA MA+ QT +LP +FGL L HPA   I + V
Sbjct: 67  VAIMATGMVFIIVTRHIDLAVGALLATCSAAMAMTQTAILPQVFGLELGHPAIPWIAMLV 126

Query: 125 GLAIGTLIGAFQGWMVGFLTIPAFIVTLGGFLVWRNVAWYLTDGQTIGPLDSTFLVFGGT 184
           GL  GT+IGAFQG++VG+L IPAFIVTLGG LVWRNVAWY+T+GQTIGPLD TF+  GG 
Sbjct: 127 GLVTGTVIGAFQGYLVGYLMIPAFIVTLGGLLVWRNVAWYMTNGQTIGPLDPTFMTLGGI 186

Query: 185 SGTLGTTLSWVVGIVATLLALAALWNSRRAKQGHGFPVKPAWAEAVIAGSIAASILGFVA 244
           +GTLG TLSW+VG+VA + A  ALW+ R+ K  H  PVKP WAE  + G ++ +ILGFVA
Sbjct: 187 NGTLGATLSWIVGLVAVVAACWALWSGRKNKIAHDAPVKPVWAELTVMGVVSVAILGFVA 246

Query: 245 ILNAYQIPARRLKRMMEAQGETMPEGLVVGYGLPISVLILIATAVVMTIIARRTRLGRYI 304
           ILN+Y++P  RL+R+ EA+GE MPEG    YG+P SVL+LIA AV MT+IA++TR GRYI
Sbjct: 247 ILNSYEVPTARLRRLFEARGEVMPEGYTEVYGIPYSVLLLIAVAVAMTVIAKKTRFGRYI 306

Query: 305 FATGGNPDAAELSGINTRLLTVKIFALMGFLCALSAVVASARLANHSNDIGTLDELRVIA 364
           FATGGNPDAAELSGINTR+LTVK+FALMG LCA+SA+VASARL NHSNDIGTLDELRVIA
Sbjct: 307 FATGGNPDAAELSGINTRMLTVKVFALMGALCAISAIVASARLTNHSNDIGTLDELRVIA 366

Query: 365 AAVIGGTALSGGFGTIYGAILGALIMQSLQSGMAMVGVDAPFQNIVVGTVLVAAVWIDIL 424
           AAVIGGTAL+GG GTIYGAILGALIMQSLQSGMAMVGVDAP QNIVVGTVLVAAV IDIL
Sbjct: 367 AAVIGGTALAGGIGTIYGAILGALIMQSLQSGMAMVGVDAPLQNIVVGTVLVAAVLIDIL 426

Query: 425 YRKRVGAR 432
           YRKR+GA+
Sbjct: 427 YRKRMGAK 434


Lambda     K      H
   0.327    0.141    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 795
Number of extensions: 40
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 433
Length of database: 435
Length adjustment: 32
Effective length of query: 401
Effective length of database: 403
Effective search space:   161603
Effective search space used:   161603
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory