GapMind for catabolism of small carbon sources

 

Aligments for a candidate for mglC in Dinoroseobacter shibae DFL-12

Align Putative beta-xyloside ABC transporter, permease component, component of Glucose porter. Also bind xylose (Boucher and Noll 2011). Induced by glucose (Frock et al. 2012). Directly regulated by glucose-responsive regulator GluR (characterized)
to candidate 3609042 Dshi_2431 Monosaccharide-transporting ATPase (RefSeq)

Query= TCDB::G4FGN4
         (313 letters)



>lcl|FitnessBrowser__Dino:3609042 Dshi_2431
           Monosaccharide-transporting ATPase (RefSeq)
          Length = 328

 Score =  184 bits (467), Expect = 2e-51
 Identities = 107/302 (35%), Positives = 170/302 (56%), Gaps = 2/302 (0%)

Query: 7   KAREAGIFLILIAIVVFLGVTTREFLTVENIFTVILNVSFIAIMSFGMTMVIITSGIDLS 66
           K+ E  + L+ I I V     +  FL   N+     N +  A+++F M ++II+  IDLS
Sbjct: 21  KSWETLLLLVAIGIFVANSFASPYFLNAWNLSDATFNFTEKAMIAFAMALLIISGEIDLS 80

Query: 67  VGSILGAASVVMGLLMDEKGLSPFLSVVIGLAVGVGFGLANGLLITKARLAPFISTLGML 126
           V SI+  AS  MG  +     +P L V+IGL VG+  G  NG+L+T+  L   + T+G +
Sbjct: 81  VASIIALASTAMGAAVQMGVGTPGL-VLIGLGVGLLCGAFNGVLVTRMGLPSIVVTIGTM 139

Query: 127 SVGRGLAYVMSGGWPISPFPESFTVHGQGMVG-PVPVPVIYMAVIGVIAHIFLKYTVTGR 185
           S+ RG++Y++ G      +PESF+  GQG V   +   ++  A+I VI  + L  T  GR
Sbjct: 140 SLFRGISYIVLGDQAFRGYPESFSWFGQGYVWWVISFELVLFAIIAVIYAMLLHKTNFGR 199

Query: 186 RIYAIGGNMEASKLVGIKTDRILILVYTINGFLAAFAGFLLTAWLGVAQPNAGQGYELDV 245
            +YAIG N   +   GI+  R+  +++ + G ++  A   LTA LG  +P+   G+EL+V
Sbjct: 200 AVYAIGNNATGAMFSGIRVQRVKFILFLLTGLMSGVAAICLTARLGSTRPSIAMGWELEV 259

Query: 246 IAATVIGGTSLSGGEGTILGAFLGAVIMGVLRNGMILLGVSSFWQQVVIGIVIIIAIAID 305
           +   V+GG S+ GG GTILG  + A +MG++  G+ LL V      +VIG ++I  IA+ 
Sbjct: 260 VTMVVLGGVSILGGSGTILGVVIAAFVMGLVTFGLGLLNVPGIVMSIVIGALLIGVIALP 319

Query: 306 QI 307
           ++
Sbjct: 320 RL 321


Lambda     K      H
   0.328    0.145    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 344
Number of extensions: 21
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 313
Length of database: 328
Length adjustment: 28
Effective length of query: 285
Effective length of database: 300
Effective search space:    85500
Effective search space used:    85500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory