Align Glutamate/aspartate import permease protein GltK (characterized)
to candidate 3606890 Dshi_0320 polar amino acid ABC transporter, inner membrane subunit (RefSeq)
Query= SwissProt::P0AER5 (224 letters) >FitnessBrowser__Dino:3606890 Length = 432 Score = 99.8 bits (247), Expect = 7e-26 Identities = 67/226 (29%), Positives = 118/226 (52%), Gaps = 13/226 (5%) Query: 7 SSIVPSLPYL----LDGLVITLKITVTAVVIGILWGTMLAVMRLSSFAPVAWFAKAYVNV 62 S + SLP + + G +I + + + + + G LA+ R S+ + ++ Sbjct: 208 SVVALSLPQVESRFIGGFMINFILGTSGIALSLPLGIALALGRQSNLPIIKGVCVVFIEF 267 Query: 63 FRSIPLVMVLLWFYLIVPGFLQNVLGLSPKNDIRLISAMVAFSMFEAAYYSEIIRAGIQS 122 R +PL+ +L +++ FL G S +R+I + ++F +AY +E IR G+ + Sbjct: 268 IRGVPLITLLFVASVMLAYFLPP--GTSFDLVLRVI---IMITLFASAYIAEAIRGGLAA 322 Query: 123 ISRGQSSAALALGMTHWQSMKLIILPQAFRAMVPLLLTQGIVLFQDTSLVYVLSLADFFR 182 + RGQ A +LG+ +WQSM+LIILPQA + +P ++ I LF+DT+LV ++S+ D Sbjct: 323 LPRGQYEAGDSLGLDYWQSMRLIILPQALKISIPSIVNIAIGLFKDTTLVSIISMFDMLG 382 Query: 183 TAS----TIGERDGTQVEMILFAGFVYFVISLSASLLVSYLKRRTA 224 + E G E++ FAG ++FV S +L+R+ A Sbjct: 383 MIQGPILSSTEWFGVYWELLGFAGVLFFVFCYGISQYSQWLERQLA 428 Lambda K H 0.330 0.140 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 224 Length of database: 432 Length adjustment: 27 Effective length of query: 197 Effective length of database: 405 Effective search space: 79785 Effective search space used: 79785 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory