Align PTS-dependent dihydroxyacetone kinase 2, dihydroxyacetone-binding subunit DhaK; EC 2.7.1.121 (characterized)
to candidate 3607105 Dshi_0527 Glycerone kinase (RefSeq)
Query= SwissProt::Q92EU2 (331 letters) >FitnessBrowser__Dino:3607105 Length = 333 Score = 293 bits (751), Expect = 3e-84 Identities = 152/332 (45%), Positives = 210/332 (63%), Gaps = 2/332 (0%) Query: 1 MRRLVNDGYEAVEEMLAGYVAAQGKYVDFAENDKRVIVSKQMSEEPRVRIIVGGGSGHEP 60 M++++N + V+EMLAG +AA +Y + +V+ ++ +V I+ GGGSGH P Sbjct: 1 MKKILNKPEDYVDEMLAGLIAAHPEYYRLHGDTGKVVARANPGKDGKVGIVTGGGSGHLP 60 Query: 61 LFLGYVGKDFADAAVVGNINTSPSPEPCYNAVKAVDSGKGCLYMYGNYAGDVMNFDMGAE 120 +F GYVG+ DA +G++ SPS E +A++ DSG G L +YGNY GDVMNFDM E Sbjct: 61 VFTGYVGEGLLDACAIGDVFASPSAEQMADAIRVADSGAGVLRLYGNYGGDVMNFDMAGE 120 Query: 121 MAADDGIRVETVLVTDDIYSAE--NVEDRRGVAGDLIVFKAAASAAAKGLDLDAVKQAAE 178 + D I TVL+ DD+ SA E RRGVAG + FK A +AA +G DLD V A+ Sbjct: 121 LVEFDDITCTTVLLADDVASAPPAEAEKRRGVAGMVYAFKIAGAAAEEGRDLDGVTAVAQ 180 Query: 179 KANANTFSMGVALSSSTLPVTGKAIFEMKEGEMEVGMGIHGEPGIKRTSIEPADKVVDQI 238 KA S+G ALS T+P GK FE+ E EME+GMGIHGEPG+ R ++ AD++ +++ Sbjct: 181 KAADACRSIGAALSPCTVPQAGKPTFEIAEDEMEMGMGIHGEPGVWRGKLQTADQIAEEM 240 Query: 239 MGYLIEEMKLTAGEEVHVLINGLGGLPVMDQYICYRRVDEILKEKGVHIHSPLVGNYATS 298 M L+ +M + G+ V V++N LG P + YI YRRV L+ G I PLVG YATS Sbjct: 241 MDRLLADMPIGNGDRVSVMVNSLGATPPEELYILYRRVKARLEAAGARIVMPLVGRYATS 300 Query: 299 MDMIGMSITLVRLDDELKDLLDTPCDTPYFKV 330 M+M G+S TL +LDDEL+ LL PCD +++V Sbjct: 301 MEMAGVSFTLCKLDDELEKLLLAPCDCAFWRV 332 Lambda K H 0.317 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 321 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 331 Length of database: 333 Length adjustment: 28 Effective length of query: 303 Effective length of database: 305 Effective search space: 92415 Effective search space used: 92415 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory