Align Polar amino acid ABC transporter, inner membrane subunit; Flags: Precursor (characterized, see rationale)
to candidate 3608831 Dshi_2223 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= uniprot:B2TBJ7 (240 letters) >FitnessBrowser__Dino:3608831 Length = 295 Score = 77.8 bits (190), Expect = 2e-19 Identities = 64/239 (26%), Positives = 109/239 (45%), Gaps = 41/239 (17%) Query: 23 LMTVALTLAALAVGAVFGALVAAAKLSRFRTLRVIGDIYTTVFRGVPELLVI-------- 74 L+ V AAL +G FG +AA S+ LR +G YT++ RG+P++ Sbjct: 38 LLLVVTAPAALFLG--FGGAIAAR--SQIAPLRWLGKGYTSMVRGIPDIAFFLFVPIALD 93 Query: 75 ----YLFYF------------GGSTLVTSVGQL---FGAEGFVGVPPFVVGALAVGMISG 115 YL + G +V + +L + F + +A ++ G Sbjct: 94 QGLEYLRHHWKCPDWTQAVRQGNDFVVCAEAKLPLSTSPQWVHETYGFTLAVIAFAVVFG 153 Query: 116 AYQAEVYRSAVLAVSRGELEAARSIGMPTLTMARRILIPQVLRFALPGIGNVWQLSLKDS 175 A+ A V A+ AV R ++E A + GM RIL+PQ+ +ALPG+ N+WQ+ +K + Sbjct: 154 AFAANVLYGAMTAVPRAQIETAEAYGMTRRQAFWRILVPQMWVYALPGLSNLWQILVKAT 213 Query: 176 ALISVTGLAELLRTSQVAAGSTHQYFTFFVVGG----------ALYLIMTSISNRVFNR 224 L+ + G+ +++ ++ G F+ + G YL +TS+S R+F R Sbjct: 214 PLLFLLGIEDIVYWARELGGVQSARFSDYPHGDWRLWYFLGLLVFYLALTSVSERIFAR 272 Lambda K H 0.327 0.141 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 116 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 240 Length of database: 295 Length adjustment: 25 Effective length of query: 215 Effective length of database: 270 Effective search space: 58050 Effective search space used: 58050 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory