Align Methionine import ATP-binding protein MetN 2, component of L-Histidine uptake porter, MetIQN (characterized)
to candidate 3608030 Dshi_1437 glycine betaine/L-proline ABC transporter, ATPase subunit (RefSeq)
Query= TCDB::Q9HT70 (335 letters) >FitnessBrowser__Dino:3608030 Length = 351 Score = 168 bits (425), Expect = 2e-46 Identities = 93/230 (40%), Positives = 138/230 (60%), Gaps = 2/230 (0%) Query: 26 LNIQAGQIFGLIGHSGAGKSTLLRLINRLEEPSGGRILVEGEDVTALDAEGLRRFRQR-V 84 L+++ G+IF ++G SG+GKSTL+R NRL EP+ GRI +EG DV AL + L+RFR R + Sbjct: 52 LSVRRGEIFCIMGLSGSGKSTLVRHFNRLLEPTAGRIEIEGTDVMALGTQELQRFRNRQI 111 Query: 85 GMIFQHFNLLSSKTVADNIAMPLRLAGGFSRAEVDARVSELLARVGLSDHARKYPAQLSG 144 GM+FQ+F L+ ++V DN+AMPL + + E + + +L V L K+ +L G Sbjct: 112 GMVFQNFALMPHRSVLDNVAMPLEIRK-VPKNERMRQAAAILDIVELGAWGAKFAHELPG 170 Query: 145 GQKQRVGIARALACRPSILLCDEATSALDPQTTASVLQLLAEINRELKLTIVLITHEMDV 204 G +QRVG+ARALA P +LL DE SALDP + +++ LK T + ITH++D Sbjct: 171 GMQQRVGLARALAANPDVLLMDEPFSALDPLIRRQLQDEFIRLSKILKKTTIFITHDLDE 230 Query: 205 IRRVCDQVAVMDGGAIVEQGDVADVFLHPQHPTTRRFVFEAERVDEDERH 254 R+ D++A+M G +V+ G D+ +HP FV R+ H Sbjct: 231 AVRIGDRIAIMRDGKVVQMGTAEDIVMHPADDYVADFVAGISRLKVVHAH 280 Lambda K H 0.322 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 305 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 351 Length adjustment: 29 Effective length of query: 306 Effective length of database: 322 Effective search space: 98532 Effective search space used: 98532 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory