Align ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, ATPase component (characterized)
to candidate 3607933 Dshi_1341 ABC transporter related (RefSeq)
Query= reanno::Smeli:SMc02121 (258 letters) >FitnessBrowser__Dino:3607933 Length = 362 Score = 151 bits (382), Expect = 2e-41 Identities = 85/239 (35%), Positives = 140/239 (58%), Gaps = 5/239 (2%) Query: 19 IEITNMNKWYGDFHVLRDINLRVMRGERIVVAGPSGSGKSTMIRCINRLEEHQKGKIVVD 78 +E++++ + + V+ D+++RVM G+ + GPSG GKST +R I ++ G + VD Sbjct: 9 LEVSHLVRDFQGQRVVDDVSIRVMPGQVTCLLGPSGCGKSTTLRIIAGVDRQDSGTLTVD 68 Query: 79 GIELTNDLKKIDEVRREVGMVFQHFNLFPHLTILENCTLAPIWVRKMPKKEAEQVAMHFL 138 G +++D + R VG++FQ F LFPHL + +N RK + A ++ L Sbjct: 69 GEVVSSDDIHLPPEARSVGLMFQDFALFPHLCVADNVGFGLSGSRKEKRARAHEL----L 124 Query: 139 ERVKIPEQALKYPGQLSGGQQQRVAIARSLCMRPKILLFDEPTSALDPEMVKEVLD-TMV 197 +RV + A K+P QLSGG+QQRVA+AR++ RP+++L DEP S LD + + D T+ Sbjct: 125 DRVGLLGDAGKFPHQLSGGEQQRVALARAIAPRPRVMLMDEPFSGLDNRLRDGIRDETLE 184 Query: 198 GLAEEGMTMICVTHEMGFARQVANRVIFMDQGQIVEQNSPAEFFDNPQHERTKLFLSQI 256 L +EG ++ VTHE A ++A+ + M G+IV+Q +P +++P + F S I Sbjct: 185 VLKDEGTAVLLVTHEPEEAMRMADNIALMRGGKIVQQGAPYNVYNSPVDKAAAAFFSDI 243 Lambda K H 0.322 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 249 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 362 Length adjustment: 27 Effective length of query: 231 Effective length of database: 335 Effective search space: 77385 Effective search space used: 77385 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory