Align Transmembrane component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate 3610344 Dshi_3725 inner-membrane translocator (RefSeq)
Query= uniprot:Q1MCU0 (300 letters) >FitnessBrowser__Dino:3610344 Length = 294 Score = 133 bits (334), Expect = 6e-36 Identities = 87/291 (29%), Positives = 153/291 (52%), Gaps = 15/291 (5%) Query: 7 QLLNGLTLGSIYGLVAIGYTMVYGIIGMINFAHGDIFMLGGFAALIVFLVLTSIFAGLPV 66 Q+LNGL LG LVA+G T+++G++ +IN +HG+ + +G + AL + + + Sbjct: 12 QMLNGLALGVSVILVALGLTIIFGLLDVINMSHGEFYAVGAYGALALAAFGVNYW----- 66 Query: 67 AVLLLVMLVVAMLMTSLWNWTIERVAYRPLRGSFR-LAPLITAIGMSITLSNFIQVTQGP 125 ++M +V ++M L T + R G+ R ++ L+ G+ + + +++ GP Sbjct: 67 ----VLMAMVPLMMIPLGIVTERYLIRRVYDGADRHVSTLLLTFGLGLIAEDVLKIIFGP 122 Query: 126 RN-KPIPPMVSSVYQFGNISVSLKQIIIIVITAVLLTIFWYIVNRTALGRAQRATEQDRK 184 +P P+ + G I + ++ +I I+A ++ ++V RT LG RA DR Sbjct: 123 NTQRPENPLPGATDLMG-IFIPTYRLFLIAISAAVILAVAFVVYRTRLGAIVRAASFDRN 181 Query: 185 MAALLGVNVDQTISITFVMGAALAAVAGTMYLMYYGV-ASFNDGFTPGVKAFTAAVLGGI 243 MAA LGV V S F G ALA +AG + Y V + F + AFT ++GG+ Sbjct: 182 MAASLGVRVGWVYSGAFAFGVALAGLAGVLLAPIYSVFPTMGRDFI--LIAFTVVIVGGM 239 Query: 244 GSLPGAVFGGLLIGLIESLWSAYFTIAYKDVATFAILAFVLIFKPTGILGR 294 GS+ GAV G+++ I+++ S + + + F ++ VL+F+P G+ GR Sbjct: 240 GSIWGAVVAGIVLTQIQAISSLVISPVWSEPIVFGVMVLVLMFRPQGLFGR 290 Lambda K H 0.329 0.143 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 283 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 294 Length adjustment: 26 Effective length of query: 274 Effective length of database: 268 Effective search space: 73432 Effective search space used: 73432 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory