Align Histidine transport system permease protein HisM (characterized)
to candidate 3608832 Dshi_2224 polar amino acid ABC transporter, inner membrane subunit (RefSeq)
Query= SwissProt::P0A2I7 (235 letters) >FitnessBrowser__Dino:3608832 Length = 268 Score = 126 bits (317), Expect = 4e-34 Identities = 74/209 (35%), Positives = 115/209 (55%), Gaps = 13/209 (6%) Query: 33 SVVMGGLLAVILAVGRVSSNKFIRFPIWLFTYIFRGTPLYVQLLVFYSGMYTLEIVKGTD 92 +++ G LA +A+G+ S +R P F ++FRG+PL++Q + Y L+ V Sbjct: 50 ALLFGFFLATAVALGKASDRAVLRVPADWFIFVFRGSPLFIQFFLAYFLFIQLKAVSP-- 107 Query: 93 LLNAF--FRSGLNCTVLALTLNTCAYTTEIFAGAIRSVPHGEIEAARAYGFSSFKMYRCI 150 AF F S ++ L LNT AY EIF GA+RSVP G++EAA AYG + + +R + Sbjct: 108 ---AFDPFTSAWAGALVVLFLNTSAYAGEIFYGALRSVPKGDLEAADAYGLAGWTKFRRV 164 Query: 151 ILPSALRIALPAYSNEVILMLHSTALAFTATVP------DLLKIARDINSATYQPFTAFG 204 P+ LR+A P+Y+NE I + H+T L F A P D L A+ T+ PF + Sbjct: 165 TWPTMLRLAWPSYTNEAIFLFHATTLVFFAGFPAFQQRGDALYYAQYFADKTFNPFIPYP 224 Query: 205 IAAVLYLLISYVLISLFRRAERRWLQHVS 233 I A ++L++ +I +F RR +H++ Sbjct: 225 IVAFYFILLTLAVIFVFSLINRRLNRHLA 253 Lambda K H 0.330 0.141 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 9 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 268 Length adjustment: 24 Effective length of query: 211 Effective length of database: 244 Effective search space: 51484 Effective search space used: 51484 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory