Align NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate 3606953 Dshi_0381 ABC transporter related (RefSeq)
Query= TCDB::P73650 (240 letters) >FitnessBrowser__Dino:3606953 Length = 274 Score = 165 bits (417), Expect = 1e-45 Identities = 94/241 (39%), Positives = 142/241 (58%), Gaps = 9/241 (3%) Query: 4 LLVVKDVFAGYVADVPILQGINFSIAPGELVTVIGPNGAGKSTLAKTIFGLLTPSQGEII 63 LL V ++ Y + +L+G++ ++ G + ++G NGAGK+T K+I LL +GE+ Sbjct: 11 LLEVNNIEVIYNHVILVLKGVSLTVPKGGITALLGGNGAGKTTTLKSISNLLHSERGEVT 70 Query: 64 -----FKGENITGLGSDQIVRRGMCYVPQVCNVFGSLTVAENLDMGAFLHQGPTQTLKDR 118 ++G+ + L +V+RG+ V + + F LTV ENL GA+ + + D Sbjct: 71 KGTISYRGDRVQDLSPSDMVKRGVIQVMEGRHCFEHLTVEENLLTGAYTRRDGRGAIADD 130 Query: 119 ---IYTMFPKLAQRRNQRAGTLSGGERQMLAMGRALMLDPDLLLLDEPSAALSPILVKDV 175 +YT FP+L +RR +AG SGGE+QM A+GRALM P+ +LLDEPS L+P LV+++ Sbjct: 131 LELVYTYFPRLKERRKSQAGYTSGGEQQMCAIGRALMSRPETILLDEPSMGLAPQLVEEI 190 Query: 176 FAQIKAIN-ATGKAIILVEQNAKQALMMADRGYVLENGRDKLEGSGQSLLNDPLVGELYL 234 F +K +N G + +L EQN AL A GY+LE+GR +EG L +P V E YL Sbjct: 191 FTIVKNLNEREGVSFLLAEQNTNVALRFAHHGYILESGRVVMEGPAAELRENPDVKEFYL 250 Query: 235 G 235 G Sbjct: 251 G 251 Lambda K H 0.320 0.139 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 175 Number of extensions: 9 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 240 Length of database: 274 Length adjustment: 24 Effective length of query: 216 Effective length of database: 250 Effective search space: 54000 Effective search space used: 54000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory