Align Probable enoyl-CoA hydratase; EC 4.2.1.17 (uncharacterized)
to candidate 3608351 Dshi_1753 Enoyl-CoA hydratase/isomerase (RefSeq)
Query= curated2:P24162 (257 letters) >FitnessBrowser__Dino:3608351 Length = 258 Score = 333 bits (855), Expect = 2e-96 Identities = 168/258 (65%), Positives = 206/258 (79%), Gaps = 1/258 (0%) Query: 1 MSYHTIRYEISEGLAVITLDRPEVMNALNAAMRHELTAALHRARGEARAIVLTGSGRAFC 60 MSY TI I + AV+TL+RP+VMNALN+ MR E+T A+ A EAR +V+TG+GRAFC Sbjct: 1 MSYQTITLTIEDDAAVLTLNRPDVMNALNSQMRAEITDAVKLAGAEARVLVMTGAGRAFC 60 Query: 61 SGQDLGDGA-AEGLNLETVLREEYEPLLQAIYSCPLPVLAAVNGAAAGAGANLALAADVV 119 SGQDLGD A A L+LE LR+EY P+L+AI+ CP+P +AAVNG AAGAGANLALAADVV Sbjct: 61 SGQDLGDRANAANLDLERTLRDEYVPMLRAIFDCPVPTIAAVNGPAAGAGANLALAADVV 120 Query: 120 IAAQSAAFMQAFTRIGLMPDAGGTWWLPRQVGMARAMGMALFAEKIGAEEAARMGLIWEA 179 IA +SA F+QAFTRIGL+PDAGGT+WLPRQ+G A+AMG ALFA+KI A +A G+IWEA Sbjct: 121 IATESAVFLQAFTRIGLIPDAGGTYWLPRQMGFAKAMGAALFADKITARQADAWGMIWEA 180 Query: 180 VPDVDFEHHWRARAAHLARGPSAAFAAVKKAFHAGLSNPLPAQLALEARLQGELGQSADF 239 VPD +FE WRARAAHLA+GP+AA+ AVK+A +N L QLALEA+LQG++G++ DF Sbjct: 181 VPDAEFEAVWRARAAHLAKGPTAAYEAVKQALRDSFNNDLDGQLALEAKLQGKMGETRDF 240 Query: 240 REGVQAFLEKRPPHFTGR 257 +EGV AFLEKR F GR Sbjct: 241 KEGVLAFLEKRSASFEGR 258 Lambda K H 0.321 0.133 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 257 Length of database: 258 Length adjustment: 24 Effective length of query: 233 Effective length of database: 234 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory