GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ech in Dinoroseobacter shibae DFL-12

Align enoyl-CoA hydratase (EC 4.2.1.17) (characterized)
to candidate 3610445 Dshi_3826 3-hydroxyacyl-CoA dehydrogenase NAD-binding (RefSeq)

Query= BRENDA::P07896
         (722 letters)



>lcl|FitnessBrowser__Dino:3610445 Dshi_3826 3-hydroxyacyl-CoA
           dehydrogenase NAD-binding (RefSeq)
          Length = 673

 Score =  381 bits (978), Expect = e-110
 Identities = 244/681 (35%), Positives = 363/681 (53%), Gaps = 37/681 (5%)

Query: 11  LAMIRLCNPPVNAVSPTVIREVRNGLQKAGSDHTVKAIVICGANGNFCAGADIHGFSAFT 70
           LA + + NPPVNA S  V + + + + +        AI+ C A   F AG D+  F A  
Sbjct: 15  LAWVTVDNPPVNATSTAVRQGLLDAVTRVQGARL--AILRC-AGRTFIAGGDMREFDAPP 71

Query: 71  PGLALGSLVDEIQRYQKPVLAAIQGVALGGGLELALGCHYRIANAKARVGLPEVTLGILP 130
               L  +VD I+    P +A +QG  LGGGLE+A+GC YRIA    R GLPEVT+G++P
Sbjct: 72  QPPDLPDVVDAIEASATPFVAVMQGTVLGGGLEIAMGCAYRIAAPGTRFGLPEVTVGLIP 131

Query: 131 GARGTQLLPRVVGVPVALDLITSGKYLSADEALRLGILDAVVKSDPVEEAIKFAQKIIDK 190
           GA GTQ  PR+ G   A+D+  +GK LSA EA   G LDA+  +D  E A   A+ ++ +
Sbjct: 132 GAGGTQRAPRLFGWDAAIDMACAGKLLSAQEAHARGALDAI--ADDPEAA---ARALVPE 186

Query: 191 PIEPRRIFNKPVPSLPNMDSVFAEAIAKVRKQYPGVLAPETCVRSIQASVKHPYEVGIKE 250
           P  P  +  +P P  P+   + A     +  +  G  AP   + ++  +   P+  G ++
Sbjct: 187 PRIP--VSERPAPPPPDSARIAAHR-RTLAARARGQTAPLQALDALLWATG-PFREGQRK 242

Query: 251 EEKLFMYLRASGQAKALQYAFFAEKSANKWSTPSGASWKTASAQPVSSVGVLGLGTMGRG 310
           E  L + LRAS Q++AL++AFFAE++  +      A  +  + + ++ + V+G G MG G
Sbjct: 243 ERALHLSLRASDQSRALRHAFFAERTVAR-----PAVIRDRTPREIARIAVMGGGLMGAG 297

Query: 311 IAISFARVGISVVAVESDPKQLDAAKK----IITFTLEK-EASRAHQNGQASAKPKLRFS 365
           IA +    G  V  +E D    +AA+     +I   L + +  +A  +   +A   LR  
Sbjct: 298 IAAACLGAGYRVDLLERDAATAEAARDRVRGLIAGALRRGKIDQARHDAHCAA---LRTG 354

Query: 366 SSTKELSTVDLVVEAVFEDMNLKKKVFAELSALCKPGAFLCTNTSALNVDDIASSTDRPQ 425
                 +  DL +EAVFE+   K+  FA L+ +  P A L TNTS L+  +I +    P 
Sbjct: 355 VGIGHAAEADLAIEAVFEETATKRAAFAALAQVMAPDAILATNTSYLDPREIFAGIPAPD 414

Query: 426 LVIGTHFFSPAHVMRLLEVIPSRYSSPTTIATVMSLSKKIGKIGVVVGNCYGFVGNRMLA 485
             +G HFF+PAHVM+LLEV+    +S  T+AT  +L+ ++ K+ V+ G C GF+GNRMLA
Sbjct: 415 RCLGLHFFAPAHVMKLLEVVRLPETSAETLATAFALAGRLRKVAVLSGICDGFIGNRMLA 474

Query: 486 PYYNQGFFLLEEGSKPEDVDGVLEEFGFKMGPFRVSDLAGLDVGWKIRKGQGLTGPSLPP 545
            Y     ++L +G+ PE +DG +  +G  MGPF   DL+GL +    R+ Q  T P+   
Sbjct: 475 AYRRAAEYMLADGALPEQIDGAMRAYGMAMGPFEAQDLSGLHIAEANRRRQDATRPA--- 531

Query: 546 GTPVRKRGNSRYSPLGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFLSQYREV 605
                     RY  L D LC  GR GQ+ GKGWY Y +   R  + DP ++  ++ Y   
Sbjct: 532 --------RERYVTLSDQLCALGRTGQRAGKGWYAYAEG-DRRPRVDPAVTALITDYSAA 582

Query: 606 HHIEQRTISKEEILERCLYSLINEAFRILEEGMAARPEHIDVIYLHGYGWPRHKGGPMFY 665
           H + +RT    EI  R L  L NE  R++EEG+A     +D++ LHGYG+PR +GGP+F 
Sbjct: 583 HGLPRRTHDAGEIQARLLAVLANEGARLVEEGIADSDAAVDMVKLHGYGFPRWRGGPLFA 642

Query: 666 AASVGLPTVLEKLQKYYRQNP 686
           A   G  T+   L      +P
Sbjct: 643 ARQAGDATIRAALDALDAASP 663


Lambda     K      H
   0.319    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1023
Number of extensions: 54
Number of successful extensions: 8
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 722
Length of database: 673
Length adjustment: 39
Effective length of query: 683
Effective length of database: 634
Effective search space:   433022
Effective search space used:   433022
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory