GapMind for catabolism of small carbon sources

 

Aligments for a candidate for fadA in Dinoroseobacter shibae DFL-12

Align long-chain-3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.211); acetyl-CoA C-acyltransferase (EC 2.3.1.16) (characterized)
to candidate 3607421 Dshi_0835 3-hydroxyacyl-CoA dehydrogenase NAD-binding (RefSeq)

Query= BRENDA::Q64428
         (763 letters)



>lcl|FitnessBrowser__Dino:3607421 Dshi_0835 3-hydroxyacyl-CoA
           dehydrogenase NAD-binding (RefSeq)
          Length = 737

 Score =  351 bits (901), Expect = e-101
 Identities = 237/739 (32%), Positives = 370/739 (50%), Gaps = 53/739 (7%)

Query: 49  VAVIRINSPNSKVNTLNKEVQSEFVEVMNEIWANDQIRSAVLISSKPGCFVAGADINMLA 108
           VA+I  +     +N +N++   +   ++++  A+D ++  ++ S K   F  G D+N++A
Sbjct: 16  VAIITWDVQGKSMNVMNQQGFEDLDALVDKALADDTVKGIIITSGKDS-FAGGMDLNVIA 74

Query: 109 SCTTP--QEAARISQEGQK-------------MFEKLEKSPKPVVAAISGSCLGGGLELA 153
                   + AR   EG               M  K  K  KPV AA+ G+ LG GLE+ 
Sbjct: 75  KMRDDAGDDPARGLFEGVMAMHGILRKIERAGMDPKTNKGGKPVAAALPGTALGIGLEIP 134

Query: 154 IACQYRIATKDRKTVLGVPEVLLGILPGAGGTQRLPKMVGVPAAFDMMLTGRNIRADRAK 213
           +AC    A  + K  +G+PE+++GI PGAGGT R+ + +G   A  ++L G+     +AK
Sbjct: 135 LACHRIFAADNPKAKIGLPEIMVGIFPGAGGTMRVSRKLGAMQAAPILLEGKLFEPKKAK 194

Query: 214 KMGLVDQLV------DPLGPGIKSPEERTIEYLEEVAVNFAKGLADRKVSAKQSKGLMEK 267
             G+VD++V      D     + S ++  I    ++     KG      +     G M  
Sbjct: 195 MAGIVDEVVPAEELLDAAKAWVLSAKDTDIVKPWDL-----KGYKFPGGAPYHPAGFMTF 249

Query: 268 LTSYAMTIPFVRQQVYKTVEEKVKKQTKGLYPAPLKIIDAVKTGLEQGNDAGYLAESEKF 327
           + + AM                +  +T G+YPA   ++ AV  G     D     E+  F
Sbjct: 250 VGASAM----------------IHSKTMGVYPAAKALLSAVYEGAMVPFDTALKIEARWF 293

Query: 328 GELALTKESKALM-GLYNGQVLCKKNKF--GAPQKTVQQLAILGAGLMGAGIAQVSVDKG 384
             + +   S A++  L+  +   +K       P + V+++ ILGAG+MGAGIA VS + G
Sbjct: 294 TNVLMNPSSSAMIRSLFINKEALEKGAVRPDVPDQKVKKVGILGAGMMGAGIAYVSANAG 353

Query: 385 LKTLLKDTTVTGLGRGQQQVFKGLNDKVKKKALTSFERDSIFSNLIGQLDYKGFEKADMV 444
           ++ +L D       RG+      L+  + +K +T  ++D + + +    DY   E  D+V
Sbjct: 354 IEVVLIDAAQESADRGKAHAAGILDKGIARKKVTPEKKDEVLARITATTDYAALEGCDLV 413

Query: 445 IEAVFEDLAVKHKVLKEVESVTPEHCIFASNTSALPINQIAAVSQRPEKVIGMHYFSPVD 504
           +EAVFED  VK +V  + E+V P   IFA+NTS LPI+++A  S RPE+ IG+H+FSPVD
Sbjct: 414 VEAVFEDPGVKAEVTAKAEAVIPGDAIFATNTSTLPISELAKASARPEQFIGIHFFSPVD 473

Query: 505 KMQLLEIITTDKTSKDTTASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQE 564
           KM L+EII   +T     A A+    +  K  IVV D   FY  RC+ P ++E IR++ E
Sbjct: 474 KMLLVEIIKGRQTGDVAVAKALDFVRQIRKTPIVVNDARFFYANRCIIPYINEGIRMVAE 533

Query: 565 GVDPKKLDALTTGFGFPVGAATLADEVGIDVAQHVAEDLGKAFGERFGGGSV-ELLKLMV 623
           GV P  ++      G P+G   L DE  ID+   +A+    A G+ +  G+V E+L  M 
Sbjct: 534 GVTPALVENAAKLVGMPLGPLQLVDETSIDLGVKIAKATKAAMGDAYPDGAVDEVLFWMA 593

Query: 624 SKGFLGRKSGKGFYIYQSGSKNKNLNSEIDNILVNLRLPAKPEVSSDEDIQYRVITRFVN 683
            +G LGRKS  GFY Y    K   L   + +     R PA  E      +Q+R++   V 
Sbjct: 594 DEGRLGRKSNAGFYTYDEAGKRGLLWEGLAD-----RYPAAKEQPELTAVQHRLLMAQVL 648

Query: 684 EAVLCLQEGILATPEEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKVVDRLRKYESAYGTQ 743
           EAV  L++G+L    EGD+GA+ G GF P  GGP  ++D+ GA + V+        +G +
Sbjct: 649 EAVRALEDGVLMDIREGDVGAILGWGFAPWSGGPLSWLDMIGAARAVEICDALTDTHGAR 708

Query: 744 FTPCQLLRDLANNSSKKFY 762
           FT   LLR++A    + FY
Sbjct: 709 FTTPALLREMA-EKGETFY 726


Lambda     K      H
   0.317    0.135    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1175
Number of extensions: 66
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 763
Length of database: 737
Length adjustment: 40
Effective length of query: 723
Effective length of database: 697
Effective search space:   503931
Effective search space used:   503931
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory