Align 3-hydroxy-2-methylbutyryl-CoA dehydrogenase subunit (EC 1.1.1.178) (characterized)
to candidate 3607199 Dshi_0620 short-chain dehydrogenase/reductase SDR (RefSeq)
Query= metacyc::MONOMER-11802 (255 letters) >FitnessBrowser__Dino:3607199 Length = 250 Score = 102 bits (253), Expect = 1e-26 Identities = 79/252 (31%), Positives = 120/252 (47%), Gaps = 22/252 (8%) Query: 3 IANKHFIVSGAASGLGAATAQMLVEAGAKVMLVDLNAQAVEAKARELGDNARFAVADISD 62 + +K +V+GAA G+G AT ++L+E G KV ++D + A+ A+A + D D+SD Sbjct: 1 MTSKTAVVTGAARGIGLATTKLLLERGWKVAMIDRDGPAL-AEALQGLDGVHGIDCDVSD 59 Query: 63 EQAAQSAVDAAVSAFGSLHGLVNCAGIVGAEKVLGKQGPHGLASFAK---VINVNLIGSF 119 +A + + + FG + LVN AG+ GP SFA+ V+ NL G F Sbjct: 60 PEAVEGMIAETLREFGQIDALVNNAGVADF-------GPIEETSFARWKTVMETNLDGPF 112 Query: 120 NLLRLAAAAMAEGAADESGERGVIINTASIAAYDGQIGQAAYAASKGAIASLTLPAAREL 179 ++ A A+ +G ++N ASI+ + AY SK A+ LTL A EL Sbjct: 113 LCVQAATPAL-------KATKGAVVNIASISGLRASTLRVAYGTSKAAVIQLTLQQAVEL 165 Query: 180 ARFGIRVMTIAPGIFETPM-MAGMSDEVRASLAAGVPFPPRLGRPQEYAALARHIIEN-- 236 GIR + PG T + MA S E+ + +P R G QE A + Sbjct: 166 GEHGIRANCVCPGPVRTKLAMAVHSQEIIDAYHDAIPL-NRYGSEQEIAEAILFLCSERA 224 Query: 237 SMLNGEVIRLDG 248 S + G+V+ DG Sbjct: 225 SFITGQVLAADG 236 Lambda K H 0.318 0.131 0.358 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 105 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 250 Length adjustment: 24 Effective length of query: 231 Effective length of database: 226 Effective search space: 52206 Effective search space used: 52206 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory