Align ABC transporter ATP-binding protein-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate 3608116 Dshi_1521 ABC transporter related (RefSeq)
Query= TCDB::Q8DQH8 (254 letters) >FitnessBrowser__Dino:3608116 Length = 260 Score = 184 bits (468), Expect = 1e-51 Identities = 98/249 (39%), Positives = 152/249 (61%) Query: 3 LLEVKQLTKHFGGLTAVGDVTLELNEGELVGLIGPNGAGKTTLFNLLTGVYEPSEGTVTL 62 +++V+ L KHFGG AV TLE+ EG + GL+GPNGAGKTTLFN++ G +P+ G VT+ Sbjct: 1 MIKVENLHKHFGGFRAVDGATLEIAEGSITGLVGPNGAGKTTLFNVIAGNLQPTSGKVTM 60 Query: 63 DGHLLNGKSPYKIASLGLGRTFQNIRLFKDLTVLDNVLIAFGNHHKQHVFTSFLRLPAFY 122 G + G P+ + GL RTFQ F +TV +N+++ G + ++ ++ + Sbjct: 61 LGEDITGLPPHDLFHKGLLRTFQIAHEFGSMTVRENLMMVPGAQSGETMWNAWFKRGQIA 120 Query: 123 KSEKELKAKALELLKIFDLDGDAETLAKNLSYGQQRRLEIVRALATEPKILFLDEPAAGM 182 + E L KA E+L+ +D + A NLS GQ++ LE+ R + + KI+FLDE AG+ Sbjct: 121 REEAALGKKADEVLEFLTIDHLRDERAGNLSGGQKKLLELGRTMMVDAKIVFLDEVGAGV 180 Query: 183 NPQETAELTELIRRIKDEFKITIMLIEHDMNLVMEVTERIYVLEYGRLIAQGTPDEIKTN 242 N + + I R+ E T +IEHDM+ + ++ + + V+ G+ +A+GT DEIK N Sbjct: 181 NRTLLGTIADAILRLNQERGYTFCVIEHDMDFIGKLCDPVIVMAEGKKLAEGTIDEIKAN 240 Query: 243 KRVIEAYLG 251 ++VIEAYLG Sbjct: 241 EQVIEAYLG 249 Lambda K H 0.319 0.139 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 260 Length adjustment: 24 Effective length of query: 230 Effective length of database: 236 Effective search space: 54280 Effective search space used: 54280 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory