Align acyl-CoA oxidase (EC 1.3.3.6) (characterized)
to candidate 3607889 Dshi_1297 acyl-CoA dehydrogenase domain protein (RefSeq)
Query= BRENDA::Q96329 (436 letters) >FitnessBrowser__Dino:3607889 Length = 387 Score = 171 bits (433), Expect = 4e-47 Identities = 114/376 (30%), Positives = 188/376 (50%), Gaps = 11/376 (2%) Query: 55 LTPEEQAIRKKVRECMEKEVAPIMTEYWEKAEFPFHITPKLGAMGVAGGSI-KGYGCPGL 113 L E +A+R+ V ++ V P+ E FP + P++G +G+ G ++ + YG G+ Sbjct: 10 LGEEVEALREMVHRWAQERVKPLAAETDRSNAFPNALWPEMGELGLLGITVDEAYGGAGM 69 Query: 114 SITANAIATAEIARVDASCSTFILVHSSLGMLTIALCGSEAQKEKYLPSLAQLNTVACWA 173 A+ +A EI+R AS HS+L + I L G++AQKEKYLP L V A Sbjct: 70 GYLAHTVAVEEISRASASIGLSYGAHSNLCVNQIKLNGTDAQKEKYLPKLVSGAHVGALA 129 Query: 174 LTEPDNGSDASGLGTTATKVEGGWKINGQKRWIGNSTFADLLIIFAR---NTTTNQINGF 230 ++E GSD G+ A K +++NG K WI N AD L+++A+ + I F Sbjct: 130 MSEAGAGSDVVGMKLRAEKRNDHYRLNGTKYWITNGPDADTLVVYAKTDPEAGSKGITAF 189 Query: 231 IVKKDAPGLKATKIPNKIGLRMVQNGDILLQNVFVPDEDRL----PGVNSFQDTSKVLAV 286 +++K+ G + +K+G+R +++ ++V VP E+ L GV L Sbjct: 190 LIEKEMAGFSTSPHFDKLGMRGSNTAELIFEDVEVPFENVLGEEGRGVAVLMSG---LDY 246 Query: 287 SRVMVAWQPIGISMGIYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLGNVQAMFLMGWR 346 RV+++ IGI G D Y+ ER+QFG P+ FQL Q K+ M + + + Sbjct: 247 ERVVLSGVNIGIMAGCLDEVMPYMTERRQFGEPIGNFQLMQGKIADMYTAMNSARAYAYE 306 Query: 347 LCKLYETGQMTPGQASLGKAWISSKARETASLGRELLGGNGILADFLVAKAFCDLEPIYT 406 + K + G++T A+ + S + + A + +GG G L D VA+ F D + + Sbjct: 307 VAKACDRGEVTRQDAAACVLYASEEGMKVAHQAVQAMGGAGFLNDSPVARMFRDAKLMEI 366 Query: 407 YEGTYDINTLVTGREV 422 GT +I ++ GRE+ Sbjct: 367 GAGTSEIRRMLVGREL 382 Lambda K H 0.319 0.133 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 347 Number of extensions: 21 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 436 Length of database: 387 Length adjustment: 31 Effective length of query: 405 Effective length of database: 356 Effective search space: 144180 Effective search space used: 144180 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory