Align 2-methylcitrate synthase (EC 2.3.3.5) (characterized)
to candidate 3608406 Dshi_1806 citrate synthase I (RefSeq)
Query= reanno::pseudo6_N2E2:Pf6N2E2_6062 (375 letters) >FitnessBrowser__Dino:3608406 Length = 430 Score = 186 bits (471), Expect = 1e-51 Identities = 129/373 (34%), Positives = 190/373 (50%), Gaps = 39/373 (10%) Query: 32 LTYRGYDVRDLAADAQFEEVAYLLLYGELPTQAQLDAYTGKLRQLRDLPQALKEVLERIP 91 L +RGY + LA + + EV YLLLYGELPT A+L+ + ++ L + + Sbjct: 68 LLHRGYPIDQLAEKSHYLEVCYLLLYGELPTAAELEDFESRVTNHTMLHEQMMNFFRGFR 127 Query: 92 ADAHPMDVMRTGCSFLGNLEPEQDFSQQHDKTD------------RLLAAFPAIMCYWYR 139 DAHPM VM +G + F HD TD RL+A P I + ++ Sbjct: 128 RDAHPMAVM------VGVVGAMSAF--YHDSTDIADPWQREVASIRLIAKMPTIAAWAFK 179 Query: 140 FSHQGQRIECVTDEVSIGGHFLHLLHGKKPSELHV------KVMNVSLILYAEHEFNAST 193 +S GQ +++ +FL + P+E +V + M+ L+A+HE NAST Sbjct: 180 YSI-GQPFVYPRNDLDYASNFLRMCFAV-PTEDYVVDPILSRAMDRIFTLHADHEQNAST 237 Query: 194 FTARVCASTLSDLFSCITAAIGSLRGPLHGGANEAAMEMIERFSSPQEAIEGTLGMLARK 253 T R+ +S+ ++ F+CI A I L GP HGGAN+A +EM++ S E + Sbjct: 238 STVRLASSSGANPFACIAAGIACLWGPAHGGANQACLEMLQEIGSVDRIPEYIARAKDKD 297 Query: 254 D--KIMGFGHAIYKDNDPRNEVIKGWSKKLADEVG---DTVLFPVSE----AIDKTMWEQ 304 D ++MGFGH +YK+ DPR +V+K + ++ + +G + +L E A+ + Sbjct: 298 DPFRLMGFGHRVYKNFDPRAKVMKQSADEVLELLGVENNPILQVAKELEAAALADPYFAD 357 Query: 305 KKLFPNADFYHASAYHFMGIPTKLFTPIFVCSRLTGWAAHVFEQ--RANNRIIRPSAEYT 362 KKLFPN DFY MG PT +FTPIF SR GW + EQ N +I RP Y Sbjct: 358 KKLFPNVDFYSGIILEAMGFPTAMFTPIFAVSRTVGWISQWKEQLEDPNLKIGRPRQLYQ 417 Query: 363 GVEQRKFVPIEQR 375 GV R +V +E+R Sbjct: 418 GVTLRDYVDVEKR 430 Lambda K H 0.321 0.135 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 430 Length adjustment: 31 Effective length of query: 344 Effective length of database: 399 Effective search space: 137256 Effective search space used: 137256 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory