Align UDP-glucose 4-epimerase (EC 5.1.3.7; EC 5.1.3.2) (characterized)
to candidate 3610487 Dshi_3868 UDP-glucose 4-epimerase (RefSeq)
Query= metacyc::BSU38860-MONOMER (339 letters) >FitnessBrowser__Dino:3610487 Length = 359 Score = 357 bits (917), Expect = e-103 Identities = 179/325 (55%), Positives = 227/325 (69%) Query: 3 ILVTGGAGYIGSHTCVELLNSGYEIVVLDNLSNSSAEALNRVKEITGKDLTFYEADLLDR 62 IL+TGGAGYIGSHT V L +G+E+V+LD+ SN++ + +R++ ITG + YE +LDR Sbjct: 5 ILLTGGAGYIGSHTYVALKAAGFEVVILDDFSNAARDVPDRLELITGAPVRLYEGSVLDR 64 Query: 63 EAVDSVFAENEIEAVIHFAGLKAVGESVAIPLKYYHNNLTGTFILCEAMEKYGVKKIVFS 122 + +F E I+AV+HFA KAVGESVA+PL Y+ N TG L + ME V ++VFS Sbjct: 65 GLLARLFTETRIDAVVHFAARKAVGESVAMPLAYFETNCTGLVGLLQEMEAACVHRLVFS 124 Query: 123 SSATVYGVPETSPITEDFPLGATNPYGQTKLMLEQILRDLHTADNEWSVALLRYFNPFGA 182 SSATVYG+P+ +P E P NPYG TK+ E IL L T+D +W+ LRYFNP GA Sbjct: 125 SSATVYGIPDVTPTPETAPHRHMNPYGLTKITGELILDALATSDPKWAFGTLRYFNPAGA 184 Query: 183 HPSGRIGEDPNGIPNNLMPYVAQVAVGKLEQLSVFGNDYPTKDGTGVRDYIHVVDLAEGH 242 H S IGEDP+ IPNNLMPY+AQVA+G+ L VFG+DYPT DGTGVRDYIHV DLAEGH Sbjct: 185 HGSALIGEDPSDIPNNLMPYIAQVAMGQRPHLQVFGDDYPTPDGTGVRDYIHVEDLAEGH 244 Query: 243 VKALEKVLNSTGADAYNLGTGTGYSVLEMVKAFEKVSGKEVPYRFADRRPGDIATCFADP 302 V +L+ +L + + NLGTG GYSVLEMV A+ G+ +PYR DRRPGD+ A Sbjct: 245 VLSLKSLLETGESHLVNLGTGRGYSVLEMVAAYSAACGRALPYRIVDRRPGDVPIYCATV 304 Query: 303 AKAKRELGWEAKRGLEEMCADSWRW 327 +A+ LG+EAKR L +MCA SW W Sbjct: 305 ERARALLGFEAKRDLAQMCASSWAW 329 Lambda K H 0.315 0.134 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 359 Length adjustment: 29 Effective length of query: 310 Effective length of database: 330 Effective search space: 102300 Effective search space used: 102300 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate 3610487 Dshi_3868 (UDP-glucose 4-epimerase (RefSeq))
to HMM TIGR01179 (galE: UDP-glucose 4-epimerase GalE (EC 5.1.3.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR01179.hmm # target sequence database: /tmp/gapView.5719.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01179 [M=332] Accession: TIGR01179 Description: galE: UDP-glucose 4-epimerase GalE Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.7e-122 392.6 0.0 6.6e-122 392.4 0.0 1.0 1 lcl|FitnessBrowser__Dino:3610487 Dshi_3868 UDP-glucose 4-epimeras Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Dino:3610487 Dshi_3868 UDP-glucose 4-epimerase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 392.4 0.0 6.6e-122 6.6e-122 2 330 .. 5 335 .. 4 337 .. 0.99 Alignments for each domain: == domain 1 score: 392.4 bits; conditional E-value: 6.6e-122 TIGR01179 2 iLvtGgaGyiGshvvrqllekgkevvvlDnlskgskealkalekit..evklvegdladkekleavleeekidaviH 76 iL+tGgaGyiGsh+ ++l+++g+evv+lD+ s++ +++ +le it v l+eg + d+ l+++++e++idav+H lcl|FitnessBrowser__Dino:3610487 5 ILLTGGAGYIGSHTYVALKAAGFEVVILDDFSNAARDVPDRLELITgaPVRLYEGSVLDRGLLARLFTETRIDAVVH 81 9******************************************999999**************************** PP TIGR01179 77 faaliavgEsvkePlkYYennvvntleLleamqkagvkkliFsssaavYgesekvpisEesplnpinpYGrsklmvE 153 faa++avgEsv+ Pl Y+e n ++ + Ll++m++a v++l+Fsssa+vYg ++ +p E++p +npYG +k++ E lcl|FitnessBrowser__Dino:3610487 82 FAARKAVGESVAMPLAYFETNCTGLVGLLQEMEAACVHRLVFSSSATVYGIPDVTPTPETAPHRHMNPYGLTKITGE 158 ***************************************************************************** PP TIGR01179 154 rilkdlkkadkelkvviLRYFnvaGAdeegeiGeasknat.hliklvaevavgkrekleifGtdyptkDGtcvRDyi 229 il++l+++d+++ + LRYFn+aGA+ + iGe++++++ +l++++a+va+g+r++l++fG+dypt+DGt+vRDyi lcl|FitnessBrowser__Dino:3610487 159 LILDALATSDPKWAFGTLRYFNPAGAHGSALIGEDPSDIPnNLMPYIAQVAMGQRPHLQVFGDDYPTPDGTGVRDYI 235 ****************************************9************************************ PP TIGR01179 230 HveDlaeaHlaalealeeggesevynlGagqgfsvkevieavkkvsgkdikveladrRaGDpaslvadaskikrelg 306 HveDlae+H+ +l+ l e+ges++ nlG+g+g+sv+e++ a ++++g+ +++++ drR+GD++ ++a+ +++++ lg lcl|FitnessBrowser__Dino:3610487 236 HVEDLAEGHVLSLKSLLETGESHLVNLGTGRGYSVLEMVAAYSAACGRALPYRIVDRRPGDVPIYCATVERARALLG 312 ***************************************************************************** PP TIGR01179 307 wkpkyddLeeiiksawdWekklke 330 +++k+d L+++++s+w+W + + + lcl|FitnessBrowser__Dino:3610487 313 FEAKRD-LAQMCASSWAWIQARAQ 335 *****9.***********987765 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (332 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.89 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory