Align Sugar transport system permease protein aka TT_C0326, component of The glucose/mannose porter TTC0326-8 plus MalK1 (ABC protein, shared with 3.A.1.1.25) (characterized)
to candidate 3608246 Dshi_1650 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= TCDB::Q72KX4 (268 letters) >FitnessBrowser__Dino:3608246 Length = 385 Score = 132 bits (331), Expect = 1e-35 Identities = 74/214 (34%), Positives = 112/214 (52%), Gaps = 3/214 (1%) Query: 57 EAFRPKFQNSVVLAVSATLLSALVGSLNGYVLAKWPFRGSGLLFALILFGMFIPYQSILI 116 E F N++ + + AT++ LV + Y LA F G LL ALI+ + +P Q LI Sbjct: 172 EGMARAFFNTLTVTIPATIIPILVAAFAAYALAWMEFPGRALLIALIVGLLVVPLQLALI 231 Query: 117 PLFQFMKSIGLYGSLFGLVLVHVIYGIPIVTLIFRNYYSEIPDELVEAARIDGAGFFGIF 176 PL +IG+ G L H +G+P+ + RNY +P +++E A++DGA F IF Sbjct: 232 PLLTLHNAIGIGKGYLGTWLAHTGFGMPLAIYLLRNYMVGLPRDIIENAKVDGATDFQIF 291 Query: 177 RHVILPLSVPAFVVVAIWQFTQIWNEFLFAVTL---TRPESQPITVALAQLAGGEAVKWN 233 ++LPLS PA AI+QF WN+ L A ++ +T + +L G W Sbjct: 292 TKIVLPLSFPALASFAIFQFLWTWNDLLVAKVFLIDATGQTTVMTNQIVELLGTRGGNWE 351 Query: 234 LPMAGAILAALPTLLVYILLGRYFLRGLLAGSVK 267 + A ++ LLV+ + R+ +RGLLAGSVK Sbjct: 352 ILATAAFVSIAVPLLVFFSMQRFLVRGLLAGSVK 385 Lambda K H 0.330 0.146 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 290 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 268 Length of database: 385 Length adjustment: 28 Effective length of query: 240 Effective length of database: 357 Effective search space: 85680 Effective search space used: 85680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory