Align LacF, component of Lactose porter (characterized)
to candidate 3607126 Dshi_0548 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= TCDB::P29823 (298 letters) >FitnessBrowser__Dino:3607126 Length = 288 Score = 117 bits (293), Expect = 3e-31 Identities = 82/277 (29%), Positives = 131/277 (47%), Gaps = 13/277 (4%) Query: 20 FVAPAIALISVFMLYPILRSLVLSLYTGRGMMLK---FSGTGNLVRLWNDPVFWQALQNT 76 F+ PA+ +++ + P+L +L SL+ L+ F G N + D VFWQA+ T Sbjct: 13 FIGPAVIGLALVGIAPLLYALWTSLHFYNLTKLRRVEFIGLENYWTVLTDEVFWQAMGRT 72 Query: 77 VIFFVVQVPIMITMALILAAMLNNPKLRY-SGLFRTMIFLPCVSSLVAYSILFKSMFSLD 135 +P+ I + L +A +L+ P L L R + LP ++ +L + MF+ Sbjct: 73 FFLLGTALPLQIALGLGIALVLHQPGLTLVKTLARLSLVLPMATTYAVVGLLGQVMFNQK 132 Query: 136 GVVNNTLLAIGIIGEPIGWLTDPFWAKVLIIIAITWRWTGYNMIFYLAALQNIDRSIYEA 195 V N LL G I W+ DP A +II W+WT + + LA L + + EA Sbjct: 133 FGVVNQLLG----GADINWIGDPENAFAMIIFWDVWQWTPFVALVLLAGLTMVPGEVEEA 188 Query: 196 AKIDGVPSWGRFAFLTIPMLKPVILFTTITSTIGTLQLFDEVYNFTEGTGGPANSTLTLS 255 A+++ W ++ +P L P ++ I T TL+LFD V+ T GGP +ST +S Sbjct: 189 ARLETKSKWTVLRYVQLPFLLPGLVAVLILRTADTLKLFDMVFTLTR--GGPGSSTEFIS 246 Query: 256 LYIYNLTFRFMPSFSYAATVSYVIVLMVAVLSFLQFY 292 L I + FR F + I+L++ + Q Y Sbjct: 247 LMIQRVGFR---GFDQGLASAQAIILLIITIVLAQIY 280 Lambda K H 0.329 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 298 Length of database: 288 Length adjustment: 26 Effective length of query: 272 Effective length of database: 262 Effective search space: 71264 Effective search space used: 71264 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory