Align ABC transporter for Lactose, permease component 2 (characterized)
to candidate 3607838 Dshi_1246 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= reanno::Smeli:SM_b21654 (272 letters) >FitnessBrowser__Dino:3607838 Length = 282 Score = 134 bits (337), Expect = 2e-36 Identities = 82/271 (30%), Positives = 138/271 (50%), Gaps = 6/271 (2%) Query: 8 AAMAATYGFLGLMAFLSVFPFIWMVLGATNSSIDIIKGKLLPGAA-FA--TNVANFFTLV 64 AA G + L L + P I + + + + D G A FA N A FT Sbjct: 12 AAQLTYQGMIPLALILWLLPLIAVAIFSVKPAGDFAAGNYWGWPAEFAGFENYARVFTDS 71 Query: 65 NVPLVFWNSAKIAIVATVLTLAVSSLAGYGFEMFRSRRRERVYRAMLLTLMIPFAALMIP 124 +P NS I I + +A+S + G+ ++R R ++ + +PF LM+P Sbjct: 72 EMPRYILNSFMITIPTVIGAVALSCMTGFALGIYRFRGNLLIFFMFIAGNFVPFQILMVP 131 Query: 125 LFVMMGKAGLINTHLAVVLPSIG--SAFVIFYFRQSTKAFPSELRDAAKVDGLKEWQIFL 182 + + GL NT +VL I + F + R +A P EL +AA+V+G+ EW+IF Sbjct: 132 VRDLTVDMGLYNTKTGLVLFHIAFQTGFCTLFMRNFIRALPYELIEAARVEGVAEWRIFW 191 Query: 183 FIYVPVMRSTYAAAFVIVFMTAWNNYLWPLIVLQTNETKTITLVISSLASAYYPDYGVVM 242 F+ +P+M+ AA V++F WN+Y W +++ Q + +T I+S + + Y ++ Sbjct: 192 FVVLPLMKPAIAALSVLIFTFIWNDYFWAVVLTQGPNAQPVTAGITSFNAQFGIAYNMLS 251 Query: 243 VGTILATLPTLAVFFFMQRQFVQGM-LGSVK 272 G+++A LP + +FF MQ+ F+ G+ LG+VK Sbjct: 252 AGSLIAALPPVMMFFLMQKHFIAGLTLGAVK 282 Lambda K H 0.331 0.141 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 229 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 282 Length adjustment: 25 Effective length of query: 247 Effective length of database: 257 Effective search space: 63479 Effective search space used: 63479 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory