Align ABC transporter for Lactose, permease component 2 (characterized)
to candidate 3608623 Dshi_2016 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= reanno::Smeli:SM_b21654 (272 letters) >FitnessBrowser__Dino:3608623 Length = 284 Score = 139 bits (349), Expect = 9e-38 Identities = 88/265 (33%), Positives = 143/265 (53%), Gaps = 9/265 (3%) Query: 17 LGLMAFLSVFPF-IWMV-LGATNSSIDIIKGK--LLPGAAFATNVANFFTL-VNVP--LV 69 LGL+ ++ F IW+ + +T S +I++ LLPG N T +N P L+ Sbjct: 20 LGLIIGVAFIFFPIWLAFVASTVSQPEIVRPPMPLLPGDQLVENYTRALTAGINAPVALM 79 Query: 70 FWNSAKIAIVATVLTLAVSSLAGYGFEMFRSRRRERVYRAMLLTLMIPFAALMIPLFVMM 129 NS +A+ + +A+S L+ + FR R + + LTLM+P ++P + ++ Sbjct: 80 LGNSLIMALGIALGKIAISLLSAFAIVYFRFPGRMLFFWLIFLTLMLPVEVRIVPTYEVI 139 Query: 130 GKAGLINTHLAVVLPSIGSAFVIFYFRQSTKAFPSELRDAAKVDGLKEWQIFLFIYVPVM 189 G++N++ ++LP + SA F FRQ P EL +AA+VDG + + F I +P+ Sbjct: 140 ANFGMLNSYQGLILPLVASATATFLFRQFFMTVPDELAEAARVDGARPMRFFFDILLPMS 199 Query: 190 RSTYAAAFVIVFMTAWNNYLWPLIVLQTNETKTITLVISSL--ASAYYPDYGVVMVGTIL 247 R+ AA FVI+F+ WN YLWPL++ E TI + I + + D+ V+M +IL Sbjct: 200 RTNIAALFVILFIYGWNQYLWPLLITTDPEMNTIVMGIKQMFPSGDDTADWPVIMATSIL 259 Query: 248 ATLPTLAVFFFMQRQFVQGMLGSVK 272 A +P + V MQR FV+G++ S K Sbjct: 260 AMVPPVIVVITMQRLFVRGLVESEK 284 Lambda K H 0.331 0.141 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 260 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 284 Length adjustment: 25 Effective length of query: 247 Effective length of database: 259 Effective search space: 63973 Effective search space used: 63973 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory