Align LacK, component of Lactose porter (characterized)
to candidate 3608244 Dshi_1648 ABC transporter related (RefSeq)
Query= TCDB::Q01937 (363 letters) >FitnessBrowser__Dino:3608244 Length = 373 Score = 342 bits (877), Expect = 9e-99 Identities = 190/341 (55%), Positives = 238/341 (69%), Gaps = 13/341 (3%) Query: 1 MAEVRLTDIRKSYGSLEVIKGVNLEVSSGEFVVFVGPSGCGKSTLLRMIAGLEDISSGEL 60 MA+++LT + K+YG ++V+ +NL++ GE +VFVGPSGCGKSTLLRMIAGLE I+ G L Sbjct: 1 MADLKLTGVEKAYGDVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTL 60 Query: 61 TIGGTVMNDVDPSKRGIAMVFQTYALYPHMTVRENMGFALRFAGMAKDEIERRVNAAAKI 120 I GTV+NDV P++RGIAMVFQ+YALYPHMTVRENM FAL+ A ++ EI+ V AAA+ Sbjct: 61 EIDGTVVNDVPPAQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEK 120 Query: 121 LELDALMDRKPKALSGGQRQRVAIGRAIVRQPDVFLFDEPLSNLDAELRVHMRVEIARLH 180 L+L +DR PKALSGGQRQRVAIGR+IVR P V+LFDEPLSNLDA LRV R+EIA+L Sbjct: 121 LQLGQYLDRLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLK 180 Query: 181 KEL-NATIVYVTHDQVEAMTLADKIVVMRGGIVEQVGAPLALYDDPDNMFVAGFIGSPRM 239 + + +T+VYVTHDQVEAMTLA +IVV+ GG + QVG+PL LY+ P+N FVA FIGSP+M Sbjct: 181 EAMPESTMVYVTHDQVEAMTLATRIVVLAGGGIAQVGSPLELYEKPENEFVAQFIGSPKM 240 Query: 240 NFLPAVVIGQAEGGQVTVALKARPDTQLTVACATPPQG----GDAVTVGVRPEHFLPAG- 294 N LP +IG G Q TV + T A + P G AV VGVRPE + A Sbjct: 241 NLLPGKIIG--TGAQTTVEM-----TDGGRAVSDYPSDDSLMGAAVNVGVRPEDMVEAAP 293 Query: 295 SGDTQLTAHVDVVEHLGNTSYVYAHTVPGEQIIIEQEERRH 335 GD V + E LG + +Y GE I + + H Sbjct: 294 GGDYVFEGKVAITEALGEVTLLYFEAPSGEDPTIGKLQGIH 334 Lambda K H 0.320 0.137 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 363 Length of database: 373 Length adjustment: 30 Effective length of query: 333 Effective length of database: 343 Effective search space: 114219 Effective search space used: 114219 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory