Align β-glycosidase (β-gly) (EC 3.2.1.21|3.2.1.23) (characterized)
to candidate 3608250 Dshi_1654 Beta-glucosidase (RefSeq)
Query= CAZy::ABI35984.1 (431 letters) >FitnessBrowser__Dino:3608250 Length = 435 Score = 366 bits (940), Expect = e-106 Identities = 196/421 (46%), Positives = 256/421 (60%), Gaps = 17/421 (4%) Query: 8 FLWGVATSAYQIEGATQEDGRGPSIWDAFARRPGAIRDGSTGEPACDHYRRYEEDIALMQ 67 FL+GVATSAYQIEG Q G G + WD F+ PG + G AC H R EED+ L+ Sbjct: 12 FLFGVATSAYQIEGHGQ-GGAGRTHWDDFSATPGNVARAEHGARACGHLDRLEEDLDLIA 70 Query: 68 SLGVRAYRFSVAWPRILPEGRGRINPKGLAFYDRLVDRLLASGITPFLTLYHWDLPLALE 127 LGV AYRFS +W R+LPEGRG N +GL FYDRLVD LLA GI P TLYHW+LP AL Sbjct: 71 GLGVDAYRFSTSWARVLPEGRGAPNMEGLDFYDRLVDGLLARGIKPAATLYHWELPSALA 130 Query: 128 ERGGWRSRETAFAFAEYAEAVARALADRVPFFATLNEPWCSAFLGHWTGEHAPGLRNLEA 187 + GGWR+R+ A F ++ + + + DRV A +NEPWC +L H+ G HAPGLR++ A Sbjct: 131 DLGGWRNRDIASWFGDFTDTIMDRIGDRVWSAAPINEPWCVGWLSHFQGHHAPGLRDIRA 190 Query: 188 ALRAAHHLLLGHGLAVEALRAAGARRVGIVLN--FAPAYGEDPEAVDVADRY---HNRYF 242 RA HH+LL HG A+ +R G R +G V+N +A + P A+ A+ Y +N++F Sbjct: 191 TARAMHHILLAHGTAIARMRDMGMRNLGAVVNMEYAQPLDDSPTAMAAAELYDAIYNQFF 250 Query: 243 LDPILGKGYPESPFRD-PPPVP-ILSRDLELVARPLDFLGVNYYAPVRVAPGTGTLPV-R 299 L + YPE P +P D + +A PLD++G+NYY + PG P R Sbjct: 251 LSGMFHNTYPEPVLAGLAPHLPDRWQDDFDTIATPLDWVGLNYYTRKIIGPGDSPWPAYR 310 Query: 300 YLPPEGPATAMGWEVYPEGLHHLLKRLGREV--PWPLYVTENGAAYPDLWTGEAVVEDPE 357 + P T MGWEV+PEGLH LL + P+Y+TENG A V D + Sbjct: 311 EIDGPLPKTQMGWEVFPEGLHALLTMMQARFTGDLPIYITENGMA------SALPVNDAD 364 Query: 358 RVAYLEAHVEAALRAREEGVDLRGYFVWSLMDNFEWAFGYTRRFGLYYVDFPSQRRIPKR 417 R+AYL+AH+ RA +GV + GYF+WSLMDN+EW+FGY +RFGL +VDF + R PK Sbjct: 365 RLAYLDAHLAQVRRAIADGVPVDGYFIWSLMDNYEWSFGYEKRFGLVHVDFDTLVRTPKA 424 Query: 418 S 418 S Sbjct: 425 S 425 Lambda K H 0.322 0.140 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 652 Number of extensions: 40 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 435 Length adjustment: 32 Effective length of query: 399 Effective length of database: 403 Effective search space: 160797 Effective search space used: 160797 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory