Align Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; EC 2.3.1.168; Branched-chain alpha-keto acid dehydrogenase complex component E2; BCKAD-E2; BCKADE2; Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto acid dehydrogenase complex; Dihydrolipoamide branched chain transacylase; Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase (uncharacterized)
to candidate 3608768 Dshi_2160 pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase (RefSeq)
Query= curated2:P37942 (424 letters) >FitnessBrowser__Dino:3608768 Length = 420 Score = 224 bits (570), Expect = 5e-63 Identities = 139/421 (33%), Positives = 224/421 (53%), Gaps = 19/421 (4%) Query: 5 QMTMPQLGESVTEGTISKWLVAPGDKVNKYDPIAEVMTDKVNAEVPSSFTGTITELVGEE 64 ++ MP L ++ EGT++KW+V GD V+ D +AE+ TDK E + G I +++ Sbjct: 4 EILMPALSPTMEEGTLAKWMVKEGDSVSSGDLLAEIETDKATMEFEAVDDGIIGKILVAA 63 Query: 65 G-QTLQVGEMICKIETEGAN-PAEQKQEQPAASEAAENPVAKSAGAADQPNKKR----YS 118 G ++V +I + EG AE+ EQP + + A A P K S Sbjct: 64 GTDDVKVNTLIAILLEEGEELGAEKPAEQPPEPASVQQEAAPQETAKAPPPKTGDRVFAS 123 Query: 119 PAVLRLAGEHGIDLDQVTGTGAGGRITRKDIQRLIETGGVQEQNPEELKTAAPAPKSASK 178 P RLA + G+DL ++ G+G GRI + D+ + V EQ A AP++ Sbjct: 124 PLARRLAKQKGLDLSEIRGSGPHGRIVKADVDAAEQPAAVPEQ--------AAAPQTRQP 175 Query: 179 PEPKEETSYPASAAGDK---EIPVTGVRKAIASNMKRSKTEIPHAWTMMEVDVTNMVAYR 235 PK +S AS D+ E+ + G+RK IA+ + +K IPH + ++ ++ +R Sbjct: 176 EGPKSASSV-ASIFADRPFTEVSLDGMRKTIAARLTEAKQTIPHFYLRRAANLDALLTFR 234 Query: 236 NSIKDSFKKTEGFNLTFFAFFVKAVAQALKEFPQMNSMWAGDKIIQKKDINISIAVATED 295 + + G L+ F +KA A+AL+ P N++WA D+I+Q + ++++AVA E Sbjct: 235 TELNAQLAPS-GKKLSVNDFVIKACARALQSVPHANAVWAEDRILQMQRSDVAVAVAIEG 293 Query: 296 SLFVPVIKNADEKTIKGIAKDITGLAKKVRDGKLTADDMQGGTFTVNNTGSFGSVQSMGI 355 LF PVIK+AD+K+I +++++ LA + R+ KL + GGTF ++N G FG + Sbjct: 294 GLFTPVIKDADQKSISALSEEMKDLAARARERKLAPSEYVGGTFAISNLGMFGIENFDAV 353 Query: 356 INYPQAAILQVESIVKRPVVMDNGMIAVRDMVNLCLSLDHRVLDGLVCGRFLGRVKQILE 415 IN P AIL V + VK+P V +G + V +++ LS+DHRV+DG V L + LE Sbjct: 354 INPPHGAILAVGAGVKKPTVDADGAVTVATQMSMTLSVDHRVIDGSVGAALLAEIVSGLE 413 Query: 416 S 416 + Sbjct: 414 N 414 Lambda K H 0.312 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 398 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 424 Length of database: 420 Length adjustment: 32 Effective length of query: 392 Effective length of database: 388 Effective search space: 152096 Effective search space used: 152096 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory