GapMind for catabolism of small carbon sources

 

Aligments for a candidate for liuB in Dinoroseobacter shibae DFL-12

Align Methylcrotonoyl-CoA carboxylase (EC 6.4.1.4) (characterized)
to candidate 3607893 Dshi_1301 Carbamoyl-phosphate synthase L chain ATP-binding (RefSeq)

Query= reanno::Smeli:SM_b21124
         (662 letters)



>lcl|FitnessBrowser__Dino:3607893 Dshi_1301 Carbamoyl-phosphate
           synthase L chain ATP-binding (RefSeq)
          Length = 661

 Score =  682 bits (1761), Expect = 0.0
 Identities = 370/656 (56%), Positives = 446/656 (67%), Gaps = 14/656 (2%)

Query: 1   MFSKLLIANRGEIACRIIRTARRLGIRTVAVYSDADGDALHVALADEAIRIGGAPAAESY 60
           MF ++LIANRGEIACR+I T RRLG++TVAV+SD D  A HVA+AD A+ +GGA   +SY
Sbjct: 1   MFERILIANRGEIACRVIDTCRRLGVQTVAVHSDVDAGARHVAMADMAVNLGGAAPRDSY 60

Query: 61  LASAPIVQAARSVGAQAIHPGYGFLSENADFAEAVAEAGMIFVGPPPAAIRAMGLKDAAK 120
           L    I+ AAR+ GA+AIHPGYGFLSEN DF EAVA AG++F+GP  AAIRAMGLKDAAK
Sbjct: 61  LRGEAIIAAARATGAEAIHPGYGFLSENPDFVEAVAAAGLVFIGPSAAAIRAMGLKDAAK 120

Query: 121 ALMERSGVPVVPGYHGEEQDASFLADRAREIGYPVLIKARAGGGGKGMRRVERQEDFGPA 180
           ALM  +GVPVVPGY G +QD + LA  A  IGYPVLIKA AGGGGKGMRRVE  E F  A
Sbjct: 121 ALMAEAGVPVVPGYQGADQDPARLAAEAEAIGYPVLIKAVAGGGGKGMRRVEGPEGFAGA 180

Query: 181 LEAARREAESAFGDGSVLLERYLTKPRHIEMQVFGDRHGNIVHLFERDCSLQRRHQKVIE 240
           LEAAR EA  AFG+  VLLE+Y+  PRHIE+QVFGD     VHLFERDCSLQRRHQKVIE
Sbjct: 181 LEAARAEARGAFGNDHVLLEKYVATPRHIELQVFGD-GARAVHLFERDCSLQRRHQKVIE 239

Query: 241 EAPAPGMTAEVRRAMGDAAVRAAQAIGYVGAGTVEFIADVTNGLWPDHFYFMEMNTRLQV 300
           EAPAPGMT E+R AMG AAVRAA+AIGY GAGTVEFI D ++GL PD F+FMEMNTRLQV
Sbjct: 240 EAPAPGMTPEMRAAMGAAAVRAAEAIGYAGAGTVEFIVDASDGLRPDRFWFMEMNTRLQV 299

Query: 301 EHPVTEAITGIDLVEWQLRVASGEPLPKKQADISMNGWAFEARLYAEDPARGFLPATGRL 360
           EHPVTEA+TG+DLV WQLRVASGEPLP +Q D+S+ G AFEARLYAED  +GFLPATGRL
Sbjct: 300 EHPVTEAVTGVDLVAWQLRVASGEPLPARQEDLSLRGHAFEARLYAEDVPKGFLPATGRL 359

Query: 361 TELSFPEGTSRVDSGVRQGDTITPYYDPLIAKLIVHGQNRSAALGRLQDALKECRIGGTV 420
           T L+FP   +R+++GVR GD I+P+YDP+IAKL+VHG  R +AL +L   L  C + G+V
Sbjct: 360 THLAFP-ADARIETGVRAGDEISPWYDPMIAKLVVHGPTRQSALRKLDRVLAGCEVAGSV 418

Query: 421 TNRDFLIRLTEEHDFRSGHPDTGLIDREIERLTAPVAPGDEALALAAIFSTGALDPNRST 480
           TN  FL  L     F +G  DTGLIDRE+E L+    P   A ALAA+ + G  +     
Sbjct: 419 TNLAFLRALARHGGFFAGEVDTGLIDREVETLSPAPVPCSRARALAALGAAGLHEGGPDG 478

Query: 481 DPWSSLGSWQIWGDAHRMVVIEHADVRATVTLASRGRDQFAVRAGASTLPVLVLDRFEGG 540
                   + +W    +   +   +      + +RG   F V  G +T  +        G
Sbjct: 479 ------AGFTLWAPLVQAQGLRFGEAEIEARIETRGAGSFRVGIGEATHEIT-----RRG 527

Query: 541 ARLEVAGQKRLIRFSRDREALTLFHGGRNLVFHVPDGLTGGQSSEIADDELVAPMPGLVK 600
               V G     R       +++F  G N  F  PD L    ++      + APMPGLVK
Sbjct: 528 GAWWVDGAPTPARIVVHAAGVSVF-WGNNYHFTAPDPLHRAGAAGPGAGHVEAPMPGLVK 586

Query: 601 LVRVGAGDAVTKGQALVVMEAMKMELTLSASREGTIANVHVAEGAQVSEGTVLVTL 656
            V V  GD V +G  L ++EAMKME TL+A R+G ++ V VAEGAQVS G  L+ L
Sbjct: 587 AVFVAPGDTVAQGARLAILEAMKMEHTLTAGRDGVVSEVLVAEGAQVSAGAPLILL 642


Lambda     K      H
   0.319    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1329
Number of extensions: 68
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 662
Length of database: 661
Length adjustment: 38
Effective length of query: 624
Effective length of database: 623
Effective search space:   388752
Effective search space used:   388752
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory