Align Putative enoyl-CoA hydratase protein; EC 4.2.1.17 (characterized, see rationale)
to candidate 3607896 Dshi_1304 Enoyl-CoA hydratase/isomerase (RefSeq)
Query= uniprot:Q92VJ6 (261 letters) >FitnessBrowser__Dino:3607896 Length = 262 Score = 277 bits (709), Expect = 1e-79 Identities = 142/257 (55%), Positives = 173/257 (67%) Query: 3 FDTIRCAIDQRGVARVTLARSEKHNALSATMIGELTAVVGRLATDASIRAVILDAEGKSF 62 F+T+ A D RGV VTLAR +KHNA++A MI EL + LA DA++R V+L G+SF Sbjct: 4 FETLEVARDGRGVVTVTLARPDKHNAMNAAMIAELHGLARSLAADAAVRVVVLTGAGRSF 63 Query: 63 CAGGDLDWMRQQFSADRPTRIAEATRLAMMLKALNDLPKPLIARVHGNAFGGGVGLISVC 122 CAGGDL WMR Q +AD TR EA LA ML A N LPKP+I R+ G AFGGGVGL++VC Sbjct: 64 CAGGDLGWMRAQMAADPDTRSREARSLAQMLGAWNTLPKPVIGRIQGQAFGGGVGLMAVC 123 Query: 123 DTVIAASGAQFGLTETRLGLIPATISPYVIARTGEARARPLFMSARVFGAEEAKVAGFVT 182 D + A+FGLTETRLGLIPATI PYV+AR G+A AR +FMSAR+F EA G + Sbjct: 124 DVAVGVQDARFGLTETRLGLIPATIGPYVVARMGQACARRVFMSARLFDGAEAVRLGLLA 183 Query: 183 TVVDGTMLDGAVEAAVTAYLVAAPGAAGRAKRLARSLGLPITDAVIAATIEQLADTWETD 242 V LD AVEA V YL APGA AK L LG +T+A I AT+ L + WE+D Sbjct: 184 RAVPEAELDAAVEAEVAPYLAVAPGAVAAAKALTLELGGTVTEAQIDATVAALRERWESD 243 Query: 243 EAREGVSAFFERRNPSW 259 EA EG++AFF++R W Sbjct: 244 EAAEGIAAFFDKRKARW 260 Lambda K H 0.321 0.133 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 262 Length adjustment: 25 Effective length of query: 236 Effective length of database: 237 Effective search space: 55932 Effective search space used: 55932 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory