Align methylglutaconyl-CoA hydratase (EC 4.2.1.18) (characterized)
to candidate 3610342 Dshi_3723 Enoyl-CoA hydratase/isomerase (RefSeq)
Query= BRENDA::F4JML5 (301 letters) >FitnessBrowser__Dino:3610342 Length = 267 Score = 127 bits (318), Expect = 4e-34 Identities = 72/234 (30%), Positives = 127/234 (54%), Gaps = 5/234 (2%) Query: 67 NAINKEMLKSLQNAFESIHQDNSARVVMIRSLVPGVFCAGADLKERRTMSPSEVHTYVNS 126 N I+ + L+ AFE++ D++ RV+++R+ F +G + SP V ++ Sbjct: 38 NVISMDQRDQLRAAFEALDADDAVRVIVLRAEGEH-FSSGGYIHGFLDASPEHVSHLADN 96 Query: 127 LRYMFSFIEALSIPTIAAIEGAALGGGLEMALACDLRICGENAVFGLPETGLAIIPGAGG 186 + + + P IAA +G G G E++LACD RI ++ + LPE L IPG+GG Sbjct: 97 VAAPWRCAK----PVIAANKGYTFGVGFEISLACDFRIAAKSTFYALPEQKLGQIPGSGG 152 Query: 187 TQRLSRLVGRSVSKELIFTGRKIDAIEAANKGLVNICVTAGEAHEKAIEMAQQINEKGPL 246 + RL L+G + +K+++ R+I +A + G+ V + E ++ ++ P+ Sbjct: 153 SARLQALIGLARTKDVVMRSRRISGQQAFDWGIAVELVEDDKLEEATAKLVNELRSFSPM 212 Query: 247 AIKMAKKAIDEGIETNMASGLEVEEMCYQKLLNTQDRLEGLAAFAEKRKPLYTG 300 A + AKK +++ +A+G+E+E CY +L ++D EG+ AF EKRKP + G Sbjct: 213 AQRTAKKLLNDSENATVATGIELEGHCYSRLRQSEDFAEGVKAFHEKRKPTFVG 266 Lambda K H 0.318 0.134 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 267 Length adjustment: 26 Effective length of query: 275 Effective length of database: 241 Effective search space: 66275 Effective search space used: 66275 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory