Align High-affinity branched-chain amino acid transport ATP-binding protein BraF, component of Branched chain amino acid uptake transporter. Transports alanine (characterized)
to candidate 3610346 Dshi_3727 ABC transporter related (RefSeq)
Query= TCDB::P21629 (255 letters) >FitnessBrowser__Dino:3610346 Length = 246 Score = 182 bits (462), Expect = 6e-51 Identities = 100/251 (39%), Positives = 155/251 (61%), Gaps = 10/251 (3%) Query: 4 PILEVSGLTMRFGGLLAVNGVNLKVEEKQVVSMIGPNGAGKTTVFNCLTGFYQPTGGLIR 63 PIL+ L + FGGL AV+ ++ Q+ ++IGPNGAGKTT+FN ++G +P G + Sbjct: 3 PILQTDRLGISFGGLRAVDAISFDALPNQITTVIGPNGAGKTTLFNLISGALKPGSGSVN 62 Query: 64 LDGEEIQGLPGHKIARKGVVRTFQNVRLFKEMTAVENL-LVAQHRHLNTNFLAGLFKTPA 122 LDG ++ ++ R G+ R+FQ LF +MT ENL L Q ++ + L +T Sbjct: 63 LDGRDVTRAGPAELQRAGLARSFQITNLFFDMTVRENLRLATQVLEPASHLMRPLRRT-- 120 Query: 123 FRRSEREAMEYAAHWLEEVNLTEFANRSAGTLAYGQQRRLEIARCMMTRPRILMLDEPAA 182 R+ + E A + L + + G L++G+QRRLEIA C+ P++LMLDEP Sbjct: 121 -GRAANKVDELIARF----ELHDKVHEQVGYLSHGEQRRLEIAMCLACEPKVLMLDEPTQ 175 Query: 183 GLNPKETDDLKALIAKLRSEHNVTVLLIEHDMKLVMSISDHIVVINQGAPLADGTPEQIR 242 G++ +T++ +ALI L +V++LLIEHD+ +VM++SDH++V++QG +ADGTP ++R Sbjct: 176 GMSHADTEETEALIRGLTD--HVSILLIEHDIGIVMAVSDHVIVMHQGQKIADGTPTEVR 233 Query: 243 DNPDVIKAYLG 253 NP V AY G Sbjct: 234 ANPAVQAAYFG 244 Lambda K H 0.320 0.137 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 8 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 246 Length adjustment: 24 Effective length of query: 231 Effective length of database: 222 Effective search space: 51282 Effective search space used: 51282 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory