Align branched chain amino acid/phenylalanine ABC transporter membrane subunit LivH (EC 7.4.2.2) (characterized)
to candidate 3608113 Dshi_1518 inner-membrane translocator (RefSeq)
Query= ecocyc::LIVH-MONOMER (308 letters) >FitnessBrowser__Dino:3608113 Length = 336 Score = 125 bits (313), Expect = 2e-33 Identities = 95/315 (30%), Positives = 156/315 (49%), Gaps = 40/315 (12%) Query: 19 GSTYALIAIGYTMVYGIIGMINFAHGEVYMIGSYVSFMIIAALMMMGIDTGWL---LVAA 75 GS AL A+G T++YGI+ NFAHG+ G+ + + A +GI G L L+A Sbjct: 22 GSQLALGALGVTLIYGILRFSNFAHGDTMAFGTMATILFTWAFQSIGISLGPLPTALLAL 81 Query: 76 GFVGAIVIASAYGWSIERVAYRPVRNSKRL--IALISAIGMSIFLQNYVSLTEGSRDVAL 133 F I++ A +R+ Y+ R K + I +I+++G+ V G D Sbjct: 82 PF--GILVTGALLVGTDRLVYKFYRQQKAVPVIFVIASLGVMFVTNALVRFIIGPDDQRF 139 Query: 134 PSLFNGQWVVGHSENF--------SASITTMQAVIWIVTFLAMLALTIFIRYSRMGRACR 185 +G+ + + F ++ T Q + + + + L F+ +R G++ R Sbjct: 140 A---DGERFIISAREFRNLTGLDEGLALRTTQGLTVVTAVIVVALLFWFLNRTRTGKSMR 196 Query: 186 ACAEDLKMASLLGINTDRVIALTFVIGAAMAAVAGVLLGQFYGVINPYIGFMAGMKAFTA 245 A +++ +A L GIN +RV+ +T++I AA+A VAG L G P+ F + F A Sbjct: 197 AFSDNEDLALLSGINPERVVMVTWLIVAALATVAGTLYG-LDKSFKPFTYFQLLLPIFAA 255 Query: 246 AVLGGIGSIPGAMIGGLILGIAE-ALSSAY--------------------LSTEYKDVVS 284 A++GG+GS GA+ GG ++ +E ++ A+ LST+YK VS Sbjct: 256 AIVGGLGSPLGAIAGGFVIAFSEVTITYAFKKVLEYLLPEALEPDGLVQLLSTDYKFAVS 315 Query: 285 FALLILVLLVMPTGI 299 FA+LI+VLL PTG+ Sbjct: 316 FAILIIVLLFKPTGL 330 Lambda K H 0.328 0.141 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 244 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 336 Length adjustment: 28 Effective length of query: 280 Effective length of database: 308 Effective search space: 86240 Effective search space used: 86240 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory