Align ABC transporter membrane-spanning permease-branched chain amino acid transport, component of The branched chain hydrophobic amino acid transporter, LivJFGHM (characterized)
to candidate 3606951 Dshi_0379 inner-membrane translocator (RefSeq)
Query= TCDB::Q8DQH9 (318 letters) >FitnessBrowser__Dino:3606951 Length = 358 Score = 133 bits (334), Expect = 7e-36 Identities = 97/320 (30%), Positives = 168/320 (52%), Gaps = 36/320 (11%) Query: 19 YSLISVLVSV--GVLNLFYVQ-ILQQIGINIILAVGLNLIVGFSGQFSLGHAGFMAIGAY 75 Y +++V V + V+N ++ ++ I I A+GLN++ G+ GQ SLG GFMA+GAY Sbjct: 30 YLVLAVAVGIIPFVINDYWASAVMVPFLIWAIAAIGLNILTGYCGQVSLGTGGFMAVGAY 89 Query: 76 AAAIIGSKSPTYGAFFGAMLVGALLSGAVALLVGIPTLRLKGDYLAVATLGVSEIIRIFI 135 A + + P +L+G +++ AV +L G+P+LR+KG YLAVATL ++ +++ Sbjct: 90 ACYKLMTAFPDLNIAI-CVLLGGVITAAVGVLFGLPSLRIKGFYLAVATL-AAQFFLVWL 147 Query: 136 IN--GGSLTNGAAGILGIPNFTTW-------------QMVYFFVVITTIATL--NFLRSP 178 N A+G + P T + + ++ + +A L N R Sbjct: 148 FNKVPWFYNYSASGQINAPERTMFGYAITGPNADAAPKYLFCLAFLFVLAWLARNLTRGT 207 Query: 179 IGRSTLSVREDEIAAESVGVNTTKIKIIAFVFGAITASIAGSL-QAGFIGSV-VPKDYTF 236 IGRS +++R+ +IAAE +GVN K K+ AF + +AG+L + ++G+V V + + Sbjct: 208 IGRSWMAIRDMDIAAEIIGVNPLKAKLTAFAVSSFFVGVAGALFFSVYLGAVEVGEAFGI 267 Query: 237 INSINVLIIVVFGGLGSITGAIVSAIVLGILNMLLQDV------------ASVRMIIYAL 284 S VL +++ GGLGSI G++ A + +L +LL++V A ++ Sbjct: 268 NQSFLVLFMIIIGGLGSIFGSLAGAAFIVLLPVLLKNVMVGSLGWDTAIAAHFEFVVLGG 327 Query: 285 ALVLVMIFRPGGLLGTWELS 304 ++ +I P GL W+L+ Sbjct: 328 LIIFFLIVEPHGLARLWQLA 347 Lambda K H 0.327 0.143 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 13 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 318 Length of database: 358 Length adjustment: 28 Effective length of query: 290 Effective length of database: 330 Effective search space: 95700 Effective search space used: 95700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory