GapMind for catabolism of small carbon sources

 

Aligments for a candidate for amaB in Dinoroseobacter shibae DFL-12

Align Alpha-aminoadipic semialdehyde dehydrogenase; Alpha-AASA dehydrogenase; Aldehyde dehydrogenase family 7 member A1; Antiquitin-1; Betaine aldehyde dehydrogenase; Delta1-piperideine-6-carboxylate dehydrogenase; P6c dehydrogenase; EC 1.2.1.31; EC 1.2.1.3; EC 1.2.1.8 (characterized)
to candidate 3608018 Dshi_1425 aldehyde dehydrogenase (RefSeq)

Query= SwissProt::Q9DBF1
         (539 letters)



>lcl|FitnessBrowser__Dino:3608018 Dshi_1425 aldehyde dehydrogenase
           (RefSeq)
          Length = 484

 Score =  207 bits (528), Expect = 6e-58
 Identities = 154/494 (31%), Positives = 231/494 (46%), Gaps = 28/494 (5%)

Query: 38  QYAWLQDLGLREDNEGVY----NGSWGGRGEVITTYCPANNEPIARVRQASLKDYEETIG 93
           Q  + QD+  R D  G Y    NG+          + PA +E +A    AS    E+ I 
Sbjct: 4   QTGFAQDV--RVDFTGPYRHAINGALVDSAGSFEVFNPATDEVVAHAPNASRDQVEQAIA 61

Query: 94  KAKKAWNIWADIPAPKRGEIVRKIGDAFREKIQLLGRLVSLEMGKILVEGIGEVQEYVDV 153
            AK A   WA +   +RG  +    DA     Q L  L++ E GK               
Sbjct: 62  AAKAAQPGWAALSQDERGAYIAAYADALDAHKQELITLLTTEQGK------PRHSMATTE 115

Query: 154 CDYAAGLSRMIGGPTLPSE----RPGHALIEMWNPLGLVGIITAFNFPVAVFGWNNAIAL 209
            +YA    R +    L  E     P H +     PLG+VG IT +NFPV +  W  A  L
Sbjct: 116 VEYAIFWVREVAKRRLEDEVIEDTPEHTVKVAHTPLGVVGAITPWNFPVLLGLWKIAPCL 175

Query: 210 ITGNVCLWKGAPTTSLVSVAVTKIIAQVLEDNLLPGAICSLVCGGADIGTTMARDERVNL 269
           +TGN  + K +P T L ++   +I  QV      P  + ++V GG + G  +     +  
Sbjct: 176 VTGNTMVMKPSPYTPLCTLRFGEIAQQVF-----PAGVLNVVAGGNEQGAWLTEHPDIAK 230

Query: 270 LSFTGSTQVGKEVALMVQERFGKSLLELGGNNAIIAFEDADLSLVVPSVLFAAVGTAGQR 329
           +SFTGST  G++V         +  LELGGN+  I     D   ++P++  AA G +GQ 
Sbjct: 231 ISFTGSTATGRKVMASSSCNLKRITLELGGNDPAILLPGTDYKPLIPTLFDAAYGNSGQW 290

Query: 330 CTTVRRLFLHESIHNEVVDRLRSAYSQIRVGNPWDPNILYGPLHTKQAVSMFVRAVEEAK 389
           C  V+RL++HES++++ +    +  ++  VGN  DPN   GP+  K           + K
Sbjct: 291 CIAVKRLYVHESLYDDFLRDFVAHAAEKTVGNGMDPNTDLGPIQNKMQYGKLKDLFADVK 350

Query: 390 KQGGTVVYGGKVMDHPGNYVEPTIVTGLAHDAPIVHQETFAPILYVFKFQDEEEVFEWNN 449
            QG +V  GG++ D PGN+V  TIV     D+ +V +E F PIL + K+ D +EV    N
Sbjct: 351 AQGLSVPLGGEIPDGPGNFVPITIVDNPPKDSRVVREEPFGPILPIIKWSDLDEVVRDAN 410

Query: 450 EVKQGLSSSIFTKDLGRIFRWLGPKGS-DCGIVNVN-IPTSGAEIGGAFGGEKHTGGGRE 507
           + + GL++S++  D       +G     + G V VN I   G +I   FGG K +G G E
Sbjct: 411 DTEFGLAASVWGPDRDTA---IGVANRLEAGTVWVNEIHIHGIDI--PFGGHKQSGMGVE 465

Query: 508 SGSDAWKQYMRRST 521
           +G +  K++    T
Sbjct: 466 NGQEGLKEFTNTKT 479


Lambda     K      H
   0.319    0.137    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 746
Number of extensions: 45
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 539
Length of database: 484
Length adjustment: 35
Effective length of query: 504
Effective length of database: 449
Effective search space:   226296
Effective search space used:   226296
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory