Align crotonase (EC 4.2.1.150) (characterized)
to candidate 3607639 Dshi_1048 Enoyl-CoA hydratase/isomerase (RefSeq)
Query= metacyc::MONOMER-13469 (259 letters) >FitnessBrowser__Dino:3607639 Length = 265 Score = 145 bits (366), Expect = 8e-40 Identities = 97/260 (37%), Positives = 139/260 (53%), Gaps = 10/260 (3%) Query: 6 IILEKDGNVASITLNRPKALNALNAATLKEI-DAAINDIAEDDNVYAVIITGSG-KAFVA 63 ++L+++G VA ITLN P LNA+ A + + D A+ A D V V++ G+G +AF A Sbjct: 10 LLLDREGPVARITLNNPDRLNAMRLAMWQGLGDLAVELAASDARV--VVLRGAGDRAFCA 67 Query: 64 GADIAEMKDLTAV-EGRKFSVLGNKIFRKLENLEK---PVIAAINGFALGGGCELSLSCD 119 GADI+E + A EG + + R LE L PV+AAI G +GGG E+++ CD Sbjct: 68 GADISEFPQVRATPEG--VAAYNRTVARALEGLAALPMPVLAAIRGHCIGGGLEIAVRCD 125 Query: 120 IRIASSKAKFGQPEVGLGITPGFGGTQRLARAIGVGMAKELIYTGKVINAEEALRIGLVN 179 +R+AS A+ LG+ G LAR G A EL+YT + ++A A R GLVN Sbjct: 126 LRLASETARIAFTPAKLGLAIGADEVAALARIAGPAAAAELLYTAQPVDAARAERWGLVN 185 Query: 180 KVVEPDKLLEEAKALVDAIIVNAPIAVRMCKAAINQGLQCDIDTGVAYEAEVFGECFATE 239 + V D L++EA AL I NAP+ +R KA + + ++ + CF + Sbjct: 186 RRVPEDMLMDEADALARTIAANAPLTLRAVKAGLAAFARPGDAAAASHADALVKTCFDSA 245 Query: 240 DRVEGMTAFVEKRDKAFKNK 259 D EG AF EKR FK + Sbjct: 246 DYREGQRAFAEKRRPEFKGQ 265 Lambda K H 0.318 0.136 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 265 Length adjustment: 25 Effective length of query: 234 Effective length of database: 240 Effective search space: 56160 Effective search space used: 56160 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory