Align Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate 3608831 Dshi_2223 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= TCDB::Q9HU30 (231 letters) >FitnessBrowser__Dino:3608831 Length = 295 Score = 108 bits (270), Expect = 1e-28 Identities = 74/235 (31%), Positives = 114/235 (48%), Gaps = 39/235 (16%) Query: 15 GTWMTLKLSLAAVC-VGLLLGLLGAIAKTSKYAALRFLGGTYTTIVRGVPETLWVLMIYF 73 G++ T+ L L L LG GAIA S+ A LR+LG YT++VRG+P+ + L + Sbjct: 31 GSFGTVMLLLVVTAPAALFLGFGGAIAARSQIAPLRWLGKGYTSMVRGIPDIAFFLFVPI 90 Query: 74 GTVSGLNALGDLFGKPD--------------------LALSP--------FAAGTLALGL 105 GL L + PD L+ SP F +A + Sbjct: 91 ALDQGLEYLRHHWKCPDWTQAVRQGNDFVVCAEAKLPLSTSPQWVHETYGFTLAVIAFAV 150 Query: 106 CFGAYATEVFRGALLSIPRGHREAGQALGLSPGRIFWRIVLPQIWRVALPGLGNLYLILL 165 FGA+A V GA+ ++PR E +A G++ + FWRI++PQ+W ALPGL NL+ IL+ Sbjct: 151 VFGAFAANVLYGAMTAVPRAQIETAEAYGMTRRQAFWRILVPQMWVYALPGLSNLWQILV 210 Query: 166 KDTALVSLITLDEIMRKAQVASNATKEPFT----------FYMTAAAIYLSLTVV 210 K T L+ L+ +++I+ A+ F+ +++ YL+LT V Sbjct: 211 KATPLLFLLGIEDIVYWARELGGVQSARFSDYPHGDWRLWYFLGLLVFYLALTSV 265 Lambda K H 0.327 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 173 Number of extensions: 10 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 231 Length of database: 295 Length adjustment: 25 Effective length of query: 206 Effective length of database: 270 Effective search space: 55620 Effective search space used: 55620 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory