Align ABC transporter for L-Lysine, permease component 1 (characterized)
to candidate 3608832 Dshi_2224 polar amino acid ABC transporter, inner membrane subunit (RefSeq)
Query= reanno::pseudo6_N2E2:Pf6N2E2_2959 (242 letters) >FitnessBrowser__Dino:3608832 Length = 268 Score = 87.8 bits (216), Expect = 2e-22 Identities = 72/231 (31%), Positives = 104/231 (45%), Gaps = 18/231 (7%) Query: 12 SAFSLQGFGPLLMQGTWMTIKLSALSLLLSVLLGLLGASAKLSSVKLLRIPAQLYTTLIR 71 S F+L L+ G + A +LL L A K S +LR+PA + + R Sbjct: 25 SDFTLCEQFTLIGSGLIWNVYFGAFALLFGFFLATAVALGKASDRAVLRVPADWFIFVFR 84 Query: 72 GVPDLVLMLLIFYSLQTWLTSLTDFMEWEYIEIDPFG---AGVITLGFIY-GAYFTETFR 127 G P L + + Y L L +++ DPF AG + + F+ AY E F Sbjct: 85 GSP-LFIQFFLAYFLFIQLKAVSP-------AFDPFTSAWAGALVVLFLNTSAYAGEIFY 136 Query: 128 GAILSVPRGQVEAATAYGLKRGQRFRFVVFPQMMRFALPGIGNNWMVMLKATALVSIIGL 187 GA+ SVP+G +EAA AYGL +FR V +P M+R A P N + + AT LV G Sbjct: 137 GALRSVPKGDLEAADAYGLAGWTKFRRVTWPTMLRLAWPSYTNEAIFLFHATTLVFFAGF 196 Query: 188 ------ADLVKAAQDAGKSTYQLFYFLVLAALIYLLITSASNFILRWLERR 232 D + AQ T+ F + A ++L+T A F+ + RR Sbjct: 197 PAFQQRGDALYYAQYFADKTFNPFIPYPIVAFYFILLTLAVIFVFSLINRR 247 Lambda K H 0.329 0.142 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 184 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 268 Length adjustment: 24 Effective length of query: 218 Effective length of database: 244 Effective search space: 53192 Effective search space used: 53192 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory