Align Ornithine aminotransferase; Orn-AT; Lysine aminotransferase; Lys-AT; EC 2.6.1.13; EC 2.6.1.36 (characterized)
to candidate 3607958 Dshi_1366 aminotransferase class-III (RefSeq)
Query= SwissProt::Q5JEW1 (445 letters) >FitnessBrowser__Dino:3607958 Length = 441 Score = 167 bits (423), Expect = 6e-46 Identities = 128/426 (30%), Positives = 198/426 (46%), Gaps = 35/426 (8%) Query: 37 PIVIERGEGIRVYDVDGNVFYDFASGVGVINVGHSHPRVVEAIKKQAEKFTHYSLTDFFY 96 P + +G+ +G D +G+ N GH PR+VEAI+ QA + + + Sbjct: 29 PRMFVAADGMYYTTAEGRQVLDGTAGLWCCNAGHKRPRIVEAIQAQAAELDYAPAFQMGH 88 Query: 97 ENAIILAEKLIELAPGDIERKVVYGNSGAEANEAAMKLV------KYGTGRKQFLAFYHA 150 A LA +L+E+AP ++ V Y NSG+EA E+A+K+ + GR + + Sbjct: 89 PRAFELANRLVEIAPDGMDH-VFYTNSGSEAVESALKIALAYHRARGEAGRTRLIGRERG 147 Query: 151 FHGRTQAVLSLTASKWVQQDGFFPTM-PGVTHIPYPNPYRNTWGIDGYEEPDELTNRVLD 209 +HG +S+ V F T+ GV H+P+ + N W EL + D Sbjct: 148 YHGVNFGGISVGGI--VNNRKHFGTLLTGVDHLPHTHIPENQWS----RGMPELGAHLAD 201 Query: 210 FIEEYVFRHVPPHEIGAIFFEPIQGEGGYVVPPKGFFKALKKFADEYGILLADDEVQMGI 269 +E + H I A+ EP+ G G ++PPKG+ + L+K ++GI+L DEV G Sbjct: 202 DLERIIALH-GAETIAAVIVEPMAGSTGVLLPPKGYLQRLRKITQDHGIVLIFDEVITGF 260 Query: 270 GRTGKFWAIEHFGVEPDLIQFGKAIGGG-LPLAGVI---HRADITFDKPGR-----HATT 320 GR G + + FGV PD+I K + G +P+ V+ H D P H T Sbjct: 261 GRVGAAFGAQRFGVTPDMITCAKGLTNGVIPMGAVLCGSHIHDAFMQGPENLIELFHGYT 320 Query: 321 FGGNPVAIAAGIEVVEIVKE--LLPHVQEVGDYLHKYLEEFKEKYEVIGDARGLGLAQAV 378 + GNP+A AAG+ +E +E L ++ Y + L K VI D R LGL A+ Sbjct: 321 YSGNPIASAAGLATLETYREDDLFARALDLEPYWQEALHSLKGARHVI-DIRNLGLIGAI 379 Query: 379 EI--VKSKETKEKYPELRDRIVKESAKRGLVLLGCGDNSIRFIPPLIVTKEEIDVAMEIF 436 E+ + TK + D + +G+++ GD I PPLI+ +ID +E Sbjct: 380 ELEPISGHPTKRAFQAFLD-----AYDKGVLIRTTGD-IIALSPPLIIETAQIDRIVETL 433 Query: 437 EEALKA 442 E L A Sbjct: 434 GEVLAA 439 Lambda K H 0.320 0.141 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 518 Number of extensions: 31 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 441 Length adjustment: 32 Effective length of query: 413 Effective length of database: 409 Effective search space: 168917 Effective search space used: 168917 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory