Align Inner membrane ABC transporter permease protein (characterized, see rationale)
to candidate 3608007 Dshi_1415 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= uniprot:A8LLL4 (385 letters) >FitnessBrowser__Dino:3608007 Length = 294 Score = 89.4 bits (220), Expect = 1e-22 Identities = 63/219 (28%), Positives = 102/219 (46%), Gaps = 19/219 (8%) Query: 176 RAFFNTLTVTIPATIIPILVAAFAAYALAWMEFPGRALLIALIVGLLVVPLQLALIPLLT 235 RA NT+ VT+ I + YAL+ F +L+ L +P +T Sbjct: 85 RAGLNTMIVTLSVVAISLTFGTLGGYALSRSSFK-------YTFWILMAALIFRAMPHIT 137 Query: 236 LHNAIGIGKGYLGTW-------LAHTGFGMPLAIYLLRNYMVGLPRDIIENAKVDGATDF 288 L + + L W + P +++LR++ + +P+D+ E+A VDG T F Sbjct: 138 LVSGYLLPFFELNIWGILPTTIIVLVAINQPFTLWMLRSFFMNIPKDLDESAMVDGCTRF 197 Query: 289 QIFTKIVLPLSFPALASFAIFQFLWTWNDLLVAKVFLIDATGQTTVMTNQIVELLGTRGG 348 Q F ++++P+ +P + + +F FL +ND V L+ QT M +I LGT Sbjct: 198 QAFRRVIIPVMWPGVITTGLFSFLLAYNDFAVTAT-LLSQDNQT--MIPKIASFLGTTQQ 254 Query: 349 NWEIL-ATAAFVSIAVPLLVF-FSMQRFLVRGLLAGSVK 385 ++ A +A VS PL + QR +V GL AG+VK Sbjct: 255 EGNVMFAVSAVVSATAPLFILVLFFQRQIVSGLTAGAVK 293 Lambda K H 0.323 0.138 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 277 Number of extensions: 22 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 385 Length of database: 294 Length adjustment: 28 Effective length of query: 357 Effective length of database: 266 Effective search space: 94962 Effective search space used: 94962 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory