Align ABC-type Maltose/ Maltodextrin permease (characterized, see rationale)
to candidate 3607947 Dshi_1355 binding-protein-dependent transport systems inner membrane component (RefSeq)
Query= uniprot:Q6MNM1 (272 letters) >FitnessBrowser__Dino:3607947 Length = 404 Score = 169 bits (427), Expect = 1e-46 Identities = 90/265 (33%), Positives = 153/265 (57%), Gaps = 5/265 (1%) Query: 12 LLFSLFSIYPILYVLSVSLRPDNAFQTQ----SLEIIGPNASFKNFVDLFATTDFLIWMR 67 + F+ + P ++ SL+ A SL++ F+++ +LF +F ++ Sbjct: 141 IFFTAVVLIPFYVMVMTSLKSQQALLQNPLDFSLDLSQGWGLFRSYAELFGQFNFGTYLW 200 Query: 68 NSLVVSAATTLLGVALASTSAYALARYRFRGRNMMLFSLLMTQMFPATMLMLPFYIILSK 127 S VS T L+ +A + AYA+AR RF GR S+L+ M P +L LP YI S Sbjct: 201 TSFFVSVLTVLITLAFSIPGAYAVARLRFAGRAAFSRSILLIYMVPMIVLALPIYIAFSV 260 Query: 128 LRLIDSFWGLFLIYSSTALPFCIWQMKAYYDTIPRELEEAALLDGCSKWMIFYKIILPVS 187 L ++ +G+ LIY T +P ++ ++ Y+ +P E+EEA L+DG ++ + +KI LP++ Sbjct: 261 TGLRNTLFGIVLIYPVTTIPVALYMLQGYFRGLPAEVEEAGLMDGLNRLQVIWKITLPLA 320 Query: 188 SPALVITALFSFMSSWSEYVIAAVVLQDPQLYTLPLGLRSFQASLATQWGLYAAGALIVS 247 PAL +L+ FM +W+E+++A ++L DP +TL G+ S +S + L AGA+I + Sbjct: 321 LPALASVSLYVFMIAWNEFLLAFMLLDDPSKFTLTRGIASLNSSEIPRQHL-MAGAVIAT 379 Query: 248 VPVLILFISISRYLVSGLTMGSVKG 272 VP++ +F+ + R++ GLT GSVKG Sbjct: 380 VPIMAIFLGLERFMTKGLTAGSVKG 404 Lambda K H 0.329 0.139 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 272 Length of database: 404 Length adjustment: 28 Effective length of query: 244 Effective length of database: 376 Effective search space: 91744 Effective search space used: 91744 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory