Align Maltose-transporting ATPase (EC 3.6.3.19) (characterized)
to candidate 3607842 Dshi_1250 ABC transporter related (RefSeq)
Query= reanno::psRCH2:GFF857 (371 letters) >FitnessBrowser__Dino:3607842 Length = 351 Score = 345 bits (884), Expect = 1e-99 Identities = 200/361 (55%), Positives = 240/361 (66%), Gaps = 17/361 (4%) Query: 1 MASVTLRDICKSYDGTPITRHIDLDIEDGEFVVFVGPSGCGKSTLLRLIAGLEDITSGDL 60 M+ +TLR K Y T + +DL I DGEF VFVGPSGCGKSTLLR+IAGLE+ + G + Sbjct: 1 MSGITLRGAVKRYGETQVVHGVDLSIADGEFCVFVGPSGCGKSTLLRMIAGLEETSEGSI 60 Query: 61 LIDNQRVNDLPPKDRSVGMVFQSYALYPHMTVAENMAFGLKLASVDKREIKRRVEAVAEI 120 I + V L P +R V MVFQ+YALYPHMTVAENM FGLK+ V K EIK +V A +EI Sbjct: 61 HIGARDVTRLDPSERGVAMVFQTYALYPHMTVAENMGFGLKMNGVPKAEIKAKVAAASEI 120 Query: 121 LQLDKLLERKPKDLSGGQRQRVAIGRTMVREPKVFLFDEPLSNLDAFLRVQMRIEIARLH 180 L+LD L RKPK LSGGQRQRVAIGR +VR P+VFLFDEPLSNLDA LRV+MR+EIARLH Sbjct: 121 LKLDDYLARKPKALSGGQRQRVAIGRAIVRGPEVFLFDEPLSNLDAELRVEMRVEIARLH 180 Query: 181 QRIRSTMIYVTHDQVEAMTLADKIVVLNAGEIAQVGQPLHLYHYPKNRFVAGFLGSPQMN 240 + I +TMIYVTHDQVEAMTLADKIVVL AG + QVG PL LY P N FVAGF+GSP MN Sbjct: 181 KEIGATMIYVTHDQVEAMTLADKIVVLRAGRVEQVGAPLELYRDPDNVFVAGFIGSPAMN 240 Query: 241 FVEVRAISASPETVTIELPSGYPLTLPVDGSAVSPGDPLTLGIRPEHFVMPDEADFTFHG 300 F++ R E + L +G P LPV G+A G P+T+G+RP+H + D Sbjct: 241 FLDGRI-----ENDAVHL-AGLP-PLPVPGAAGRSG-PVTVGVRPQHIALEPGGDGYL-- 290 Query: 301 QITVAERLGQYNLLYLTLERLQDVITLCVDGNLR--VTEGETFAAGLKADKCHLFR-ENG 357 + + E LG + LYL R D L V+ + EG L D+ LF E G Sbjct: 291 -VELTESLGGVSYLYL---RGADGSRLTVEAGEEDPIAEGTPVGLSLAPDRVMLFEAETG 346 Query: 358 E 358 + Sbjct: 347 Q 347 Lambda K H 0.322 0.139 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 407 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 371 Length of database: 351 Length adjustment: 29 Effective length of query: 342 Effective length of database: 322 Effective search space: 110124 Effective search space used: 110124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory