Align ABC-type maltose transporter (EC 7.5.2.1) (characterized)
to candidate 3608008 Dshi_1416 ABC transporter related (RefSeq)
Query= BRENDA::Q70HW1 (384 letters) >FitnessBrowser__Dino:3608008 Length = 347 Score = 320 bits (821), Expect = 3e-92 Identities = 178/365 (48%), Positives = 226/365 (61%), Gaps = 22/365 (6%) Query: 1 MARVLLEHIYKTYPGQTEPTVKDFNLDIQDKEFTVFVGPSGCGKTTTLRMIAGLEDITEG 60 MA + L H+ K + V+DF+L I D+EF V +GPSGCGKTTT+RMIAGLE+ + G Sbjct: 1 MAEIRLNHVQKRWGSFVG--VEDFHLTIPDREFLVLLGPSGCGKTTTMRMIAGLEEPSSG 58 Query: 61 NLYIGDRRVNDVPPKDRDIAMVFQNYALYPHMTVYQNMAFGLKLRKVPKAEIDRRVQEAA 120 ++IGDR VN + PKDRD+AMVFQ+Y LYP+M VY+N+ F LK+RKVP+ E + RV A+ Sbjct: 59 EIWIGDRMVNALDPKDRDVAMVFQSYGLYPNMNVYENIRFPLKVRKVPEVEHEARVMRAS 118 Query: 121 KILDIAHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPLSNLDAKLRVQMRAEIRK 180 ++++ L RKP ALSGGQRQRVAL RAIVREP VFLMDEPLSNLDAKLRV RA+I+ Sbjct: 119 AMVELDDFLHRKPAALSGGQRQRVALARAIVREPNVFLMDEPLSNLDAKLRVSTRAQIKN 178 Query: 181 LHQRLQTTVIYVTHDQTEAMTMGDRIVVMRDGVIQQADTPQVVYSQPKNMFVAGFIGSPA 240 L LQ T IYVTHDQ EAMT+ DR+VVM GV+QQ TP +Y +P N FVA FIGSPA Sbjct: 179 LSHELQVTTIYVTHDQIEAMTLADRVVVMSAGVVQQVGTPMEIYDRPANTFVASFIGSPA 238 Query: 241 MNFIRGEIVQDGDAFYFRAPSISLRLPEGRYGVLKASGAIGKPVVLGVRPEDLHDEEVFM 300 MN + G V DG R + SGA G+ V LG R ED Sbjct: 239 MNLMEG-AVTDG------------TFHGDRVAIAGLSGAAGR-VTLGFRAEDA------Q 278 Query: 301 TTYPDSVLQMQVEVVEHMGSEVYLHTSIGPNTIVARVNPRHVYHVGSSVKLAIDLNKIHI 360 D + V +E +G + G + + +G+ V++ I H+ Sbjct: 279 VVDSDGQIAAPVYSMELLGDATMVTVKAGGTLVAVKAPKEFRAEIGAPVQIRIPTGICHL 338 Query: 361 FDAET 365 FDA+T Sbjct: 339 FDAQT 343 Lambda K H 0.321 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 415 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 347 Length adjustment: 30 Effective length of query: 354 Effective length of database: 317 Effective search space: 112218 Effective search space used: 112218 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory