Align ABC-type maltose transport, ATP binding protein (characterized, see rationale)
to candidate 3607842 Dshi_1250 ABC transporter related (RefSeq)
Query= uniprot:Q6MNM2 (347 letters) >FitnessBrowser__Dino:3607842 Length = 351 Score = 307 bits (786), Expect = 3e-88 Identities = 170/359 (47%), Positives = 224/359 (62%), Gaps = 22/359 (6%) Query: 1 MAKIQFSNIKKSFGSADVLKGIDLDIAPGEFLVLVGPSGCGKSTLLRTLAGLESADSGTI 60 M+ I K +G V+ G+DL IA GEF V VGPSGCGKSTLLR +AGLE G+I Sbjct: 1 MSGITLRGAVKRYGETQVVHGVDLSIADGEFCVFVGPSGCGKSTLLRMIAGLEETSEGSI 60 Query: 61 SIDGKKINDIEPQNRDIAMVFQSYALYPHMTVAENMGFGLKLKNLAAAEITKRVNEISEL 120 I + + ++P R +AMVFQ+YALYPHMTVAENMGFGLK+ + AEI +V SE+ Sbjct: 61 HIGARDVTRLDPSERGVAMVFQTYALYPHMTVAENMGFGLKMNGVPKAEIKAKVAAASEI 120 Query: 121 LQIKHLLDRKPKELSGGQRQRVALGRALSRQTPVILFDEPLSNLDAHLRSQMRLEIKRLH 180 L++ L RKPK LSGGQRQRVA+GRA+ R V LFDEPLSNLDA LR +MR+EI RLH Sbjct: 121 LKLDDYLARKPKALSGGQRQRVAIGRAIVRGPEVFLFDEPLSNLDAELRVEMRVEIARLH 180 Query: 181 HNSKSTMIYVTHDQMEATTLGDRIAVLKDGVIEQIGTPSEIYHRPKNTFIATFIGSPEMN 240 +TMIYVTHDQ+EA TL D+I VL+ G +EQ+G P E+Y P N F+A FIGSP MN Sbjct: 181 KEIGATMIYVTHDQVEAMTLADKIVVLRAGRVEQVGAPLELYRDPDNVFVAGFIGSPAMN 240 Query: 241 FLEGAV---------LEKIPWPEA--RKADQILGIRPDAFALNQGPLGTQEVALGDFQID 289 FL+G + L +P P A R +G+RP AL G G + ++ Sbjct: 241 FLDGRIENDAVHLAGLPPLPVPGAAGRSGPVTVGVRPQHIALEPGGDG--------YLVE 292 Query: 290 ISENLGGQQMLHGTLAGNNVRILVDSMDNFSMKQTLPLKIDLT--KAHLFDKKTGLNQR 346 ++E+LGG L+ + R+ V++ + + + P+ + L + LF+ +TG R Sbjct: 293 LTESLGGVSYLY-LRGADGSRLTVEAGEEDPIAEGTPVGLSLAPDRVMLFEAETGQRLR 350 Lambda K H 0.318 0.136 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 312 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 347 Length of database: 351 Length adjustment: 29 Effective length of query: 318 Effective length of database: 322 Effective search space: 102396 Effective search space used: 102396 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory