Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate 3607124 Dshi_0546 ABC transporter related (RefSeq)
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__Dino:3607124 Length = 338 Score = 302 bits (774), Expect = 8e-87 Identities = 172/370 (46%), Positives = 231/370 (62%), Gaps = 39/370 (10%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M +K+D I K Y + ++ + NLDI D EF+VFVGPSGCGKST LR +AGLE ++ G Sbjct: 1 MAGIKIDKINKFYGTTQ--ALFDINLDIEDGEFVVFVGPSGCGKSTLLRTLAGLEGVSSG 58 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 + I + + P DRD+AMVFQ+YALYPHM+V ENM FG+K+ ++ D +R+ EAA Sbjct: 59 RIEIGGRDVTTVEPADRDLAMVFQSYALYPHMTVRENMEFGMKVNGFEPDLRKERIAEAA 118 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 +L L ++L+RKP LSGGQRQRVA+GRAIV++ VFL DEPLSNLDAKLRV MR E+ Sbjct: 119 RVLQLEDYLDRKPGQLSGGQRQRVAIGRAIVKNPSVFLFDEPLSNLDAKLRVQMRVELEG 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANK 240 +H+++GAT IYVTHDQ EAMT+AD+IV+++ GRIEQ+G+P +LY++P ++ Sbjct: 179 LHKQLGATMIYVTHDQVEAMTMADKIVVLNR----------GRIEQVGSPMDLYHKPNSR 228 Query: 241 FVAGFIGSPAMNFFEVTVEKERLVNQDGLSLALPQGQEKILEEKGYLGKKVTLGIRPEDI 300 FVA FIGSPAMN F V L++ +G RPE I Sbjct: 229 FVAEFIGSPAMNVFSSDVG---------------------LQDISLDASAAFVGCRPEHI 267 Query: 301 SSDQIVHETFPNASVTADILVSELLGSESMLYVKF-GSTEFTARVNARDSHSPGEKVQLT 359 +IV + + + A + V E LG ES+LY+ G + ARV D G V L Sbjct: 268 ---EIVPD--GDGHIAATVHVKERLGGESLLYLGLKGGGQIVARVGGDDETKVGAAVSLR 322 Query: 360 FNIAKGHFFD 369 F+ + H FD Sbjct: 323 FSRHRLHQFD 332 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 359 Number of extensions: 15 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 338 Length adjustment: 29 Effective length of query: 348 Effective length of database: 309 Effective search space: 107532 Effective search space used: 107532 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory