Align MalK, component of Maltose/Maltotriose/maltodextrin (up to 7 glucose units) transporters MalXFGK (MsmK (3.A.1.1.28) can probably substitute for MalK; Webb et al., 2008) (characterized)
to candidate 3608008 Dshi_1416 ABC transporter related (RefSeq)
Query= TCDB::Q8DT25 (377 letters) >FitnessBrowser__Dino:3608008 Length = 347 Score = 308 bits (790), Expect = 1e-88 Identities = 175/372 (47%), Positives = 235/372 (63%), Gaps = 29/372 (7%) Query: 1 MTTLKLDNIYKRYPNAKHYSVENFNLDIHDKEFIVFVGPSGCGKSTTLRMIAGLEDITEG 60 M ++L+++ KR+ VE+F+L I D+EF+V +GPSGCGK+TT+RMIAGLE+ + G Sbjct: 1 MAEIRLNHVQKRW--GSFVGVEDFHLTIPDREFLVLLGPSGCGKTTTMRMIAGLEEPSSG 58 Query: 61 NLYIDDKLMNDASPKDRDIAMVFQNYALYPHMSVYENMAFGLKLRKYKKDDINKRVHEAA 120 ++I D+++N PKDRD+AMVFQ+Y LYP+M+VYEN+ F LK+RK + + RV A+ Sbjct: 59 EIWIGDRMVNALDPKDRDVAMVFQSYGLYPNMNVYENIRFPLKVRKVPEVEHEARVMRAS 118 Query: 121 EILGLTEFLERKPADLSGGQRQRVAMGRAIVRDAKVFLMDEPLSNLDAKLRVAMRAEIAK 180 ++ L +FL RKPA LSGGQRQRVA+ RAIVR+ VFLMDEPLSNLDAKLRV+ RA+I Sbjct: 119 AMVELDDFLHRKPAALSGGQRQRVALARAIVREPNVFLMDEPLSNLDAKLRVSTRAQIKN 178 Query: 181 IHRRIGATTIYVTHDQTEAMTLADRIVIMSATPNPDKTGSIGRIEQIGTPQELYNEPANK 240 + + TTIYVTHDQ EAMTLADR+V+MSA G ++Q+GTP E+Y+ PAN Sbjct: 179 LSHELQVTTIYVTHDQIEAMTLADRVVVMSA----------GVVQQVGTPMEIYDRPANT 228 Query: 241 FVAGFIGSPAMNFFEVTVEKERLVNQDGLSLALPQGQEKILEEKGYLGKKVTLGIRPEDI 300 FVA FIGSPAMN E V + + D +++A G +VTLG R ED Sbjct: 229 FVASFIGSPAMNLMEGAV-TDGTFHGDRVAIAGLSG----------AAGRVTLGFRAEDA 277 Query: 301 SSDQIVHETFPNASVTADILVSELLGSESMLYVKFGSTEFTARVNARDSHSPGEKVQLTF 360 Q+V + + A + ELLG +M+ VK G T + G VQ+ Sbjct: 278 ---QVVDS---DGQIAAPVYSMELLGDATMVTVKAGGTLVAVKAPKEFRAEIGAPVQIRI 331 Query: 361 NIAKGHFFDLET 372 H FD +T Sbjct: 332 PTGICHLFDAQT 343 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 347 Length adjustment: 29 Effective length of query: 348 Effective length of database: 318 Effective search space: 110664 Effective search space used: 110664 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory